Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 4511288..4511711 Replicon chromosome
Accession NZ_LR882963
Organism Planktothrix agardhii strain No.66

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag NMG84_RS20625 Protein ID WP_081693770.1
Coordinates 4511288..4511437 (-) Length 50 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag NMG84_RS20630 Protein ID WP_227350538.1
Coordinates 4511430..4511711 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG84_RS20595 (PANO66_04114) 4506352..4506927 + 576 WP_227397778.1 hypothetical protein -
NMG84_RS20600 (PANO66_04115) 4506931..4508640 + 1710 WP_227397777.1 hypothetical protein -
NMG84_RS20605 (PANO66_04116) 4508786..4510003 - 1218 WP_227350540.1 glycosyltransferase family 4 protein -
NMG84_RS20610 (PANO66_04117) 4510280..4510411 + 132 WP_026796378.1 photosystem II reaction center protein Ycf12 -
NMG84_RS20615 (PANO66_04118) 4510454..4510864 - 411 WP_235753243.1 DUF4346 domain-containing protein -
NMG84_RS20620 (PANO66_04119) 4511073..4511252 - 180 WP_227365709.1 hypothetical protein -
NMG84_RS20625 4511288..4511437 - 150 WP_081693770.1 type II toxin-antitoxin system YoeB family toxin Toxin
NMG84_RS20630 (PANO66_04120) 4511430..4511711 - 282 WP_227350538.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMG84_RS20635 (PANO66_04121) 4511848..4512321 - 474 WP_227357893.1 hypothetical protein -
NMG84_RS20640 (PANO66_04122) 4512409..4514130 - 1722 WP_235760406.1 solute carrier family 26 protein -
NMG84_RS20645 (PANO66_04123) 4514141..4514680 - 540 WP_254032663.1 rhodanese-like domain-containing protein -
NMG84_RS20650 (PANO66_04124) 4514784..4515473 - 690 WP_227350534.1 MBL fold metallo-hydrolase -
NMG84_RS20655 (PANO66_04125) 4515737..4516312 - 576 WP_254032664.1 Uma2 family endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-37)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(10-83)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 6014.06 Da        Isoelectric Point: 10.2321

>T289986 WP_081693770.1 NZ_LR882963:c4511437-4511288 [Planktothrix agardhii]
MSNRILAWTDEAWDNYIYWQNQDRKTLKKINKIIKICPPYPSISRKFIL

Download         Length: 150 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10448.00 Da        Isoelectric Point: 6.0673

>AT289986 WP_227350538.1 NZ_LR882963:c4511711-4511430 [Planktothrix agardhii]
VLIVVQVTAMKVVTFSEAKSQLKTVLDRVVEDADYTIITRRDADHAVVMSLDYFNGLLETVHLLKSPANAAHLERSIAQY
RQGKALEHQLIDE

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References