Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2531998..2532611 | Replicon | chromosome |
Accession | NZ_LR882950 | ||
Organism | Planktothrix agardhii strain PCC7805 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | NMG85_RS11505 | Protein ID | WP_235752057.1 |
Coordinates | 2531998..2532282 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NMG85_RS11510 | Protein ID | WP_235752056.1 |
Coordinates | 2532297..2532611 (+) | Length | 105 a.a. |
Genomic Context
Location: 2528827..2529048 (222 bp)
Type: Others
Protein ID: WP_227381101.1
Type: Others
Protein ID: WP_227381101.1
Location: 2529070..2529282 (213 bp)
Type: Others
Protein ID: WP_042156661.1
Type: Others
Protein ID: WP_042156661.1
Location: 2529416..2529733 (318 bp)
Type: Others
Protein ID: WP_235752061.1
Type: Others
Protein ID: WP_235752061.1
Location: 2529733..2530011 (279 bp)
Type: Others
Protein ID: WP_235752060.1
Type: Others
Protein ID: WP_235752060.1
Location: 2530054..2531292 (1239 bp)
Type: Others
Protein ID: WP_042156657.1
Type: Others
Protein ID: WP_042156657.1
Location: 2531282..2531860 (579 bp)
Type: Others
Protein ID: WP_235752058.1
Type: Others
Protein ID: WP_235752058.1
Location: 2531998..2532282 (285 bp)
Type: Toxin
Protein ID: WP_235752057.1
Type: Toxin
Protein ID: WP_235752057.1
Location: 2532297..2532611 (315 bp)
Type: Antitoxin
Protein ID: WP_235752056.1
Type: Antitoxin
Protein ID: WP_235752056.1
Location: 2534749..2535333 (585 bp)
Type: Others
Protein ID: WP_235766119.1
Type: Others
Protein ID: WP_235766119.1
Location: 2532677..2533252 (576 bp)
Type: Others
Protein ID: WP_235752055.1
Type: Others
Protein ID: WP_235752055.1
Location: 2533367..2533708 (342 bp)
Type: Others
Protein ID: WP_235752054.1
Type: Others
Protein ID: WP_235752054.1
Location: 2533705..2533938 (234 bp)
Type: Others
Protein ID: WP_042156647.1
Type: Others
Protein ID: WP_042156647.1
Location: 2535462..2536037 (576 bp)
Type: Others
Protein ID: WP_235766118.1
Type: Others
Protein ID: WP_235766118.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMG85_RS11475 (PCC7805_02307) | 2528827..2529048 | + | 222 | WP_227381101.1 | hypothetical protein | - |
NMG85_RS11480 (PCC7805_02308) | 2529070..2529282 | + | 213 | WP_042156661.1 | hypothetical protein | - |
NMG85_RS11485 (PCC7805_02309) | 2529416..2529733 | + | 318 | WP_235752061.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NMG85_RS11490 (PCC7805_02310) | 2529733..2530011 | + | 279 | WP_235752060.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NMG85_RS11495 (PCC7805_02311) | 2530054..2531292 | + | 1239 | WP_042156657.1 | ATP-binding protein | - |
NMG85_RS11500 (PCC7805_02312) | 2531282..2531860 | + | 579 | WP_235752058.1 | DUF4276 family protein | - |
NMG85_RS11505 (PCC7805_02313) | 2531998..2532282 | + | 285 | WP_235752057.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMG85_RS11510 (PCC7805_02314) | 2532297..2532611 | + | 315 | WP_235752056.1 | HigA family addiction module antitoxin | Antitoxin |
NMG85_RS11515 (PCC7805_02315) | 2532677..2533252 | - | 576 | WP_235752055.1 | Uma2 family endonuclease | - |
NMG85_RS11520 (PCC7805_02316) | 2533367..2533708 | - | 342 | WP_235752054.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
NMG85_RS11525 (PCC7805_02317) | 2533705..2533938 | - | 234 | WP_042156647.1 | hypothetical protein | - |
NMG85_RS11530 (PCC7805_02319) | 2534749..2535333 | + | 585 | WP_235766119.1 | transposase | - |
NMG85_RS11535 (PCC7805_02320) | 2535462..2536037 | - | 576 | WP_235766118.1 | Uma2 family endonuclease | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11221.74 Da Isoelectric Point: 9.7476
>T289975 WP_235752057.1 NZ_LR882950:2531998-2532282 [Planktothrix agardhii]
MPQKYKDKRTAKFAAGDRVKEFQAFERQAYKRLEILEAAPNKESLKALPSNRFEALGGDRKGQYSIRINDKWRICFEWTE
TENRPFHIEIVDYH
MPQKYKDKRTAKFAAGDRVKEFQAFERQAYKRLEILEAAPNKESLKALPSNRFEALGGDRKGQYSIRINDKWRICFEWTE
TENRPFHIEIVDYH
Download Length: 285 bp