Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 220937..221288 Replicon chromosome
Accession NZ_LR882944
Organism Planktothrix agardhii strain No.365

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag NMG87_RS00880 Protein ID WP_081693770.1
Coordinates 220937..221086 (-) Length 50 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag NMG87_RS00885 Protein ID WP_254033164.1
Coordinates 221079..221288 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG87_RS00855 (NO365_00182) 216636..218021 + 1386 Protein_166 cobaltochelatase subunit CobN -
NMG87_RS00860 (NO365_00183) 218435..219652 - 1218 WP_227350540.1 glycosyltransferase family 4 protein -
NMG87_RS00865 (NO365_00184) 219929..220060 + 132 WP_026796378.1 photosystem II reaction center protein Ycf12 -
NMG87_RS00870 (NO365_00185) 220103..220513 - 411 WP_227351489.1 DUF4346 domain-containing protein -
NMG87_RS00875 (NO365_00186) 220722..220901 - 180 WP_227365709.1 hypothetical protein -
NMG87_RS00880 220937..221086 - 150 WP_081693770.1 type II toxin-antitoxin system YoeB family toxin Toxin
NMG87_RS00885 (NO365_00187) 221079..221288 - 210 WP_254033164.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMG87_RS00890 (NO365_00188) 221497..221970 - 474 WP_227357893.1 hypothetical protein -
NMG87_RS00895 (NO365_00189) 222058..223797 - 1740 WP_254033165.1 solute carrier family 26 protein -
NMG87_RS00900 (NO365_00190) 223790..224329 - 540 WP_042153957.1 rhodanese-like domain-containing protein -
NMG87_RS00905 (NO365_00191) 224433..225122 - 690 WP_227350534.1 MBL fold metallo-hydrolase -
NMG87_RS00910 (NO365_00192) 225386..225961 - 576 WP_254033166.1 Uma2 family endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-37)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-59)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 6014.06 Da        Isoelectric Point: 10.2321

>T289969 WP_081693770.1 NZ_LR882944:c221086-220937 [Planktothrix agardhii]
MSNRILAWTDEAWDNYIYWQNQDRKTLKKINKIIKICPPYPSISRKFIL

Download         Length: 150 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 7845.83 Da        Isoelectric Point: 4.9949

>AT289969 WP_254033164.1 NZ_LR882944:c221288-221079 [Planktothrix agardhii]
VLDRVVEDADYTIITRRDADHAVVMSLDYFNGLLETVHLLKSPANAAHLERSIAQYRQGKALEHQLIDE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References