Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 510817..511213 Replicon chromosome
Accession NZ_LR882938
Organism Planktothrix agardhii strain No.2A

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag NMG72_RS02195 Protein ID WP_081693770.1
Coordinates 510817..510966 (-) Length 50 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A1J1JAK8
Locus tag NMG72_RS02200 Protein ID WP_026785375.1
Coordinates 510959..511213 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG72_RS02165 (NO2A_00437) 505881..506456 + 576 WP_227397778.1 hypothetical protein -
NMG72_RS02170 (NO2A_00438) 506460..508169 + 1710 WP_227397777.1 hypothetical protein -
NMG72_RS02175 (NO2A_00439) 508315..509532 - 1218 WP_227350540.1 glycosyltransferase family 4 protein -
NMG72_RS02180 (NO2A_00440) 509809..509940 + 132 WP_026796378.1 photosystem II reaction center protein Ycf12 -
NMG72_RS02185 (NO2A_00441) 509983..510393 - 411 WP_227351489.1 DUF4346 domain-containing protein -
NMG72_RS02190 (NO2A_00442) 510602..510781 - 180 WP_227350539.1 hypothetical protein -
NMG72_RS02195 510817..510966 - 150 WP_081693770.1 type II toxin-antitoxin system YoeB family toxin Toxin
NMG72_RS02200 (NO2A_00443) 510959..511213 - 255 WP_026785375.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMG72_RS02205 (NO2A_00444) 511377..511850 - 474 WP_227357893.1 hypothetical protein -
NMG72_RS02210 (NO2A_00445) 511938..513659 - 1722 WP_235760406.1 solute carrier family 26 protein -
NMG72_RS02215 (NO2A_00446) 513670..514209 - 540 WP_227397775.1 rhodanese-like domain-containing protein -
NMG72_RS02220 (NO2A_00447) 514313..515002 - 690 WP_227350534.1 MBL fold metallo-hydrolase -
NMG72_RS02225 (NO2A_00448) 515266..515841 - 576 WP_227365710.1 Uma2 family endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-37)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 6014.06 Da        Isoelectric Point: 10.2321

>T289965 WP_081693770.1 NZ_LR882938:c510966-510817 [Planktothrix agardhii]
MSNRILAWTDEAWDNYIYWQNQDRKTLKKINKIIKICPPYPSISRKFIL

Download         Length: 150 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9524.84 Da        Isoelectric Point: 6.0673

>AT289965 WP_026785375.1 NZ_LR882938:c511213-510959 [Planktothrix agardhii]
MKVVTFSEAKSQLKTVLDRVVEDADYTIITRRDADHAVVMSLDYFNGLLETVHLLKSPANAAHLERSIAQYRQGKALEHQ
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JAK8

References