Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 2215291..2216159 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | JOA04_RS10170 | Protein ID | WP_010886136.1 |
Coordinates | 2215291..2215668 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | JOA04_RS10175 | Protein ID | WP_003409886.1 |
Coordinates | 2215710..2216159 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS10120 | 2211080..2211532 | - | 453 | WP_003899095.1 | lipoprotein | - |
JOA04_RS10125 | 2211596..2211997 | + | 402 | WP_003409869.1 | hypothetical protein | - |
JOA04_RS10130 | 2211990..2212172 | - | 183 | WP_003409870.1 | hypothetical protein | - |
JOA04_RS10135 | 2212286..2212636 | - | 351 | WP_003409871.1 | hypothetical protein | - |
JOA04_RS10140 | 2212647..2213549 | - | 903 | WP_003409874.1 | hypothetical protein | - |
JOA04_RS10145 | 2213570..2213761 | - | 192 | WP_003409876.1 | hypothetical protein | - |
JOA04_RS10150 | 2213762..2214058 | - | 297 | WP_003409877.1 | hypothetical protein | - |
JOA04_RS10155 | 2214298..2214513 | + | 216 | WP_003409878.1 | antitoxin | - |
JOA04_RS10160 | 2214510..2214821 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
JOA04_RS10165 | 2214795..2215316 | - | 522 | WP_003904745.1 | hypothetical protein | - |
JOA04_RS10170 | 2215291..2215668 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
JOA04_RS10175 | 2215710..2216159 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
JOA04_RS10180 | 2216156..2216701 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
JOA04_RS10185 | 2216590..2217204 | - | 615 | WP_003901296.1 | hypothetical protein | - |
JOA04_RS10190 | 2217253..2217549 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
JOA04_RS10195 | 2217546..2217797 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
JOA04_RS10200 | 2217784..2218278 | + | 495 | WP_003899099.1 | hypothetical protein | - |
JOA04_RS10205 | 2218438..2218845 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
JOA04_RS10210 | 2218849..2219121 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
JOA04_RS10215 | 2219154..2220374 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T289931 WP_010886136.1 NZ_LR882500:2215291-2215668 [Mycobacterium tuberculosis variant microti]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT289931 WP_003409886.1 NZ_LR882500:2215710-2216159 [Mycobacterium tuberculosis variant microti]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|