Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 2213665..2214533 | Replicon | chromosome |
Accession | NZ_LR882499 | ||
Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | JN986_RS10145 | Protein ID | WP_010886136.1 |
Coordinates | 2213665..2214042 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | JN986_RS10150 | Protein ID | WP_003409886.1 |
Coordinates | 2214084..2214533 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN986_RS10095 | 2209454..2209906 | - | 453 | WP_003899095.1 | lipoprotein | - |
JN986_RS10100 | 2209970..2210371 | + | 402 | WP_003409869.1 | hypothetical protein | - |
JN986_RS10105 | 2210364..2210546 | - | 183 | WP_003409870.1 | hypothetical protein | - |
JN986_RS10110 | 2210660..2211010 | - | 351 | WP_003409871.1 | hypothetical protein | - |
JN986_RS10115 | 2211021..2211923 | - | 903 | WP_003409874.1 | hypothetical protein | - |
JN986_RS10120 | 2211944..2212135 | - | 192 | WP_003409876.1 | hypothetical protein | - |
JN986_RS10125 | 2212136..2212432 | - | 297 | WP_003409877.1 | hypothetical protein | - |
JN986_RS10130 | 2212672..2212887 | + | 216 | WP_003409878.1 | antitoxin | - |
JN986_RS10135 | 2212884..2213195 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
JN986_RS10140 | 2213169..2213690 | - | 522 | WP_003904745.1 | hypothetical protein | - |
JN986_RS10145 | 2213665..2214042 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
JN986_RS10150 | 2214084..2214533 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
JN986_RS10155 | 2214530..2215075 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
JN986_RS10160 | 2214964..2215578 | - | 615 | WP_003901296.1 | hypothetical protein | - |
JN986_RS10165 | 2215627..2215923 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
JN986_RS10170 | 2215920..2216171 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
JN986_RS10175 | 2216158..2216652 | + | 495 | WP_003899099.1 | hypothetical protein | - |
JN986_RS10180 | 2216812..2217219 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
JN986_RS10185 | 2217223..2217495 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
JN986_RS10190 | 2217528..2218748 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T289871 WP_010886136.1 NZ_LR882499:2213665-2214042 [Mycobacterium tuberculosis variant microti OV254]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT289871 WP_003409886.1 NZ_LR882499:2214084-2214533 [Mycobacterium tuberculosis variant microti OV254]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|