Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3552747..3553417 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | JN980_RS16570 | Protein ID | WP_003899954.1 |
Coordinates | 3552747..3553091 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | JN980_RS16575 | Protein ID | WP_003899955.1 |
Coordinates | 3553088..3553417 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS16540 | 3547820..3548680 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
JN980_RS16545 | 3548655..3549170 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
JN980_RS16550 | 3549410..3549703 | + | 294 | WP_003416635.1 | hypothetical protein | - |
JN980_RS16555 | 3549991..3551280 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
JN980_RS16560 | 3551627..3552061 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
JN980_RS16565 | 3552064..3552516 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
JN980_RS16570 | 3552747..3553091 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JN980_RS16575 | 3553088..3553417 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
JN980_RS16580 | 3553779..3555040 | + | 1262 | WP_105799563.1 | IS3-like element IS987 family transposase | - |
JN980_RS16585 | 3555313..3555660 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
JN980_RS16590 | 3555657..3556277 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
JN980_RS16595 | 3556437..3557702 | - | 1266 | WP_003909837.1 | hypothetical protein | - |
JN980_RS16600 | 3557870..3558079 | + | 210 | WP_003416778.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T289835 WP_003899954.1 NZ_LR882498:3552747-3553091 [Mycobacterium tuberculosis variant microti]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT289835 WP_003899955.1 NZ_LR882498:3553088-3553417 [Mycobacterium tuberculosis variant microti]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0THF6 |