Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3555256..3555926 | Replicon | chromosome |
| Accession | NZ_LR882497 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | O53332 |
| Locus tag | JN995_RS16600 | Protein ID | WP_003899954.1 |
| Coordinates | 3555256..3555600 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0THF6 |
| Locus tag | JN995_RS16605 | Protein ID | WP_003899955.1 |
| Coordinates | 3555597..3555926 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN995_RS16570 | 3550329..3551189 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
| JN995_RS16575 | 3551164..3551679 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
| JN995_RS16580 | 3551919..3552212 | + | 294 | WP_003416635.1 | hypothetical protein | - |
| JN995_RS16585 | 3552500..3553789 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
| JN995_RS16590 | 3554136..3554570 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN995_RS16595 | 3554573..3555025 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| JN995_RS16600 | 3555256..3555600 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JN995_RS16605 | 3555597..3555926 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
| JN995_RS16610 | 3556288..3557549 | + | 1262 | WP_105799563.1 | IS3-like element IS987 family transposase | - |
| JN995_RS16615 | 3557822..3558169 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
| JN995_RS16620 | 3558166..3558786 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
| JN995_RS16625 | 3558946..3560211 | - | 1266 | WP_003909837.1 | hypothetical protein | - |
| JN995_RS16630 | 3560379..3560588 | + | 210 | WP_003416778.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T289775 WP_003899954.1 NZ_LR882497:3555256-3555600 [Mycobacterium tuberculosis variant microti]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT289775 WP_003899955.1 NZ_LR882497:3555597-3555926 [Mycobacterium tuberculosis variant microti]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBK2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6LTY | |
| PDB | 6LTZ | |
| AlphaFold DB | G0THF6 |