Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2206758..2207626 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | JN993_RS10140 | Protein ID | WP_010886136.1 |
| Coordinates | 2206758..2207135 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | JN993_RS10145 | Protein ID | WP_003409886.1 |
| Coordinates | 2207177..2207626 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS10090 | 2202547..2202999 | - | 453 | WP_003899095.1 | lipoprotein | - |
| JN993_RS10095 | 2203063..2203464 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| JN993_RS10100 | 2203457..2203639 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| JN993_RS10105 | 2203753..2204103 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| JN993_RS10110 | 2204114..2205016 | - | 903 | WP_003409874.1 | hypothetical protein | - |
| JN993_RS10115 | 2205037..2205228 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| JN993_RS10120 | 2205229..2205525 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| JN993_RS10125 | 2205765..2205980 | + | 216 | WP_003409878.1 | antitoxin | - |
| JN993_RS10130 | 2205977..2206288 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN993_RS10135 | 2206262..2206783 | - | 522 | WP_162298263.1 | hypothetical protein | - |
| JN993_RS10140 | 2206758..2207135 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| JN993_RS10145 | 2207177..2207626 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| JN993_RS10150 | 2207623..2208168 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| JN993_RS10155 | 2208057..2208671 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| JN993_RS10160 | 2208720..2209016 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JN993_RS10165 | 2209013..2209264 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| JN993_RS10170 | 2209251..2209745 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| JN993_RS10175 | 2209905..2210312 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN993_RS10180 | 2210316..2210588 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| JN993_RS10185 | 2210621..2211841 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T289691 WP_010886136.1 NZ_LR882496:2206758-2207135 [Mycobacterium tuberculosis variant microti]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT289691 WP_003409886.1 NZ_LR882496:2207177-2207626 [Mycobacterium tuberculosis variant microti]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|