Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 71652..72078 | Replicon | plasmid 2 |
| Accession | NZ_LR882494 | ||
| Organism | Escherichia coli isolate 2016-17-292 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | IHO92_RS23950 | Protein ID | WP_001312861.1 |
| Coordinates | 71652..71810 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 71854..72078 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IHO92_RS23925 | 67026..67715 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| IHO92_RS23930 | 67902..68285 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| IHO92_RS23935 | 68606..69208 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| IHO92_RS23940 | 69505..70326 | - | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| IHO92_RS23945 | 70444..70731 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| IHO92_RS23950 | 71652..71810 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 71854..72078 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 71854..72078 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 71854..72078 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 71854..72078 | - | 225 | NuclAT_0 | - | Antitoxin |
| IHO92_RS23955 | 71890..72078 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| IHO92_RS23960 | 72090..72809 | - | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| IHO92_RS23965 | 72806..73240 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| IHO92_RS23970 | 73295..73492 | - | 198 | Protein_77 | hypothetical protein | - |
| IHO92_RS23975 | 73520..73753 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| IHO92_RS23980 | 73821..74360 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| IHO92_RS23985 | 74386..74592 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| IHO92_RS23990 | 75731..76702 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..97083 | 97083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T289655 WP_001312861.1 NZ_LR882494:c71810-71652 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT289655 NZ_LR882494:c72078-71854 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|