Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1066959..1067686 | Replicon | chromosome |
Accession | NZ_LR882493 | ||
Organism | Escherichia coli isolate 2016-17-292 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | IHO92_RS05200 | Protein ID | WP_000547564.1 |
Coordinates | 1066959..1067270 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | IHO92_RS05205 | Protein ID | WP_000126294.1 |
Coordinates | 1067267..1067686 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHO92_RS05170 | 1062101..1063810 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
IHO92_RS05175 | 1063820..1064362 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
IHO92_RS05180 | 1064362..1065129 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
IHO92_RS05185 | 1065126..1065536 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
IHO92_RS05190 | 1065529..1065999 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
IHO92_RS05195 | 1066024..1066785 | + | 762 | WP_094316645.1 | hypothetical protein | - |
IHO92_RS05200 | 1066959..1067270 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
IHO92_RS05205 | 1067267..1067686 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
IHO92_RS05210 | 1067800..1069224 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
IHO92_RS05215 | 1069233..1070690 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
IHO92_RS05220 | 1070950..1071960 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
IHO92_RS05225 | 1072109..1072636 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T289641 WP_000547564.1 NZ_LR882493:1066959-1067270 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT289641 WP_000126294.1 NZ_LR882493:1067267-1067686 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|