Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41580..41834 | Replicon | plasmid 5 |
| Accession | NZ_LR882061 | ||
| Organism | Escherichia coli isolate 2014-01-7375 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | IHP09_RS25555 | Protein ID | WP_001312851.1 |
| Coordinates | 41685..41834 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 41580..41638 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IHP09_RS25530 | 38070..38291 | + | 222 | WP_000412083.1 | hypothetical protein | - |
| IHP09_RS25535 | 38299..39048 | + | 750 | WP_000123038.1 | type-F conjugative transfer system pilin acetylase TraX | - |
| IHP09_RS25540 | 39122..39682 | + | 561 | WP_000139377.1 | fertility inhibition protein FinO | - |
| IHP09_RS25545 | 39836..40030 | - | 195 | WP_001115778.1 | hypothetical protein | - |
| IHP09_RS25550 | 40394..40993 | + | 600 | WP_000256073.1 | hypothetical protein | - |
| - | 41580..41638 | - | 59 | NuclAT_1 | - | Antitoxin |
| - | 41580..41638 | - | 59 | NuclAT_1 | - | Antitoxin |
| - | 41580..41638 | - | 59 | NuclAT_1 | - | Antitoxin |
| - | 41580..41638 | - | 59 | NuclAT_1 | - | Antitoxin |
| IHP09_RS25555 | 41685..41834 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| IHP09_RS25560 | 42102..42356 | + | 255 | WP_000083830.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..42660 | 42660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T289634 WP_001312851.1 NZ_LR882061:41685-41834 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 59 bp
>AT289634 NZ_LR882061:c41638-41580 [Escherichia coli]
AGATACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
AGATACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|