Detailed information of TA system TA289632

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 21720..21989
• Replicon: plasmid 5
• Accession: NZ_LR882061
• Organism: Escherichia coli isolate 2014-01-7375

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: IHP09_RS25450
• Protein ID: WP_001312861.1
• Coordinates: 21831..21989 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	21720..21785 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IHP09_RS25415	16912..17178	-	267	WP_071531731.1	hypothetical protein	-
IHP09_RS25420	17248..17454	+	207	WP_000547944.1	hypothetical protein	-
IHP09_RS25425	17480..18013	+	534	WP_000290815.1	single-stranded DNA-binding protein	-
IHP09_RS25430	18070..18303	+	234	WP_000006030.1	DUF905 family protein	-
IHP09_RS25435	18368..20332	+	1965	WP_000117208.1	ParB/RepB/Spo0J family partition protein	-
IHP09_RS25440	20401..20835	+	435	WP_000845894.1	conjugation system SOS inhibitor PsiB	-
IHP09_RS25445	20832..21551	+	720	WP_000116352.1	plasmid SOS inhibition protein A	-
-	21563..21787	+	225	NuclAT_0	-	-
-	21563..21787	+	225	NuclAT_0	-	-
-	21563..21787	+	225	NuclAT_0	-	-
-	21563..21787	+	225	NuclAT_0	-	-
-	21720..21785	-	66	-	-	Antitoxin
IHP09_RS25450	21831..21989	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
IHP09_RS25455	22911..23198	+	288	WP_000107540.1	hypothetical protein	-
IHP09_RS25460	23317..24138	+	822	WP_001234451.1	DUF945 domain-containing protein	-
IHP09_RS25465	24417..24869	-	453	WP_001469955.1	transglycosylase SLT domain-containing protein	-
IHP09_RS25470	25347..25730	+	384	WP_001137956.1	hypothetical protein	-
IHP09_RS25475	25912..26649	+	738	WP_000818288.1	hypothetical protein	-
IHP09_RS25480	26738..26905	+	168	Protein_37	TraY domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	-	1..42660	42660

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T289632 WP_001312861.1 NZ_LR882061:21831-21989 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT289632 NZ_LR882061:c21785-21720 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin