Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 21563..21989 | Replicon | plasmid 5 |
Accession | NZ_LR882061 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | IHP09_RS25450 | Protein ID | WP_001312861.1 |
Coordinates | 21831..21989 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 21563..21787 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS25415 | 16912..17178 | - | 267 | WP_071531731.1 | hypothetical protein | - |
IHP09_RS25420 | 17248..17454 | + | 207 | WP_000547944.1 | hypothetical protein | - |
IHP09_RS25425 | 17480..18013 | + | 534 | WP_000290815.1 | single-stranded DNA-binding protein | - |
IHP09_RS25430 | 18070..18303 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
IHP09_RS25435 | 18368..20332 | + | 1965 | WP_000117208.1 | ParB/RepB/Spo0J family partition protein | - |
IHP09_RS25440 | 20401..20835 | + | 435 | WP_000845894.1 | conjugation system SOS inhibitor PsiB | - |
IHP09_RS25445 | 20832..21551 | + | 720 | WP_000116352.1 | plasmid SOS inhibition protein A | - |
- | 21563..21787 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 21563..21787 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 21563..21787 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 21563..21787 | + | 225 | NuclAT_0 | - | Antitoxin |
IHP09_RS25450 | 21831..21989 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
IHP09_RS25455 | 22911..23198 | + | 288 | WP_000107540.1 | hypothetical protein | - |
IHP09_RS25460 | 23317..24138 | + | 822 | WP_001234451.1 | DUF945 domain-containing protein | - |
IHP09_RS25465 | 24417..24869 | - | 453 | WP_001469955.1 | transglycosylase SLT domain-containing protein | - |
IHP09_RS25470 | 25347..25730 | + | 384 | WP_001137956.1 | hypothetical protein | - |
IHP09_RS25475 | 25912..26649 | + | 738 | WP_000818288.1 | hypothetical protein | - |
IHP09_RS25480 | 26738..26905 | + | 168 | Protein_37 | TraY domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..42660 | 42660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T289630 WP_001312861.1 NZ_LR882061:21831-21989 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT289630 NZ_LR882061:21563-21787 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCAGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCAGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|