Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 50720..50984 Replicon plasmid 2
Accession NZ_LR882058
Organism Escherichia coli isolate 2014-01-7375

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag IHP09_RS24355 Protein ID WP_001387489.1
Coordinates 50832..50984 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 50720..50782 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHP09_RS24340 45959..48250 - 2292 WP_072742854.1 conjugal transfer protein TrbC -
IHP09_RS24345 48243..49313 - 1071 WP_039005625.1 IncI1-type conjugal transfer protein TrbB -
IHP09_RS24350 49332..50540 - 1209 WP_039005623.1 IncI1-type conjugal transfer protein TrbA -
- 50720..50782 - 63 NuclAT_0 - Antitoxin
- 50720..50782 - 63 NuclAT_0 - Antitoxin
- 50720..50782 - 63 NuclAT_0 - Antitoxin
- 50720..50782 - 63 NuclAT_0 - Antitoxin
IHP09_RS24355 50832..50984 + 153 WP_001387489.1 Hok/Gef family protein Toxin
IHP09_RS24360 51056..51307 - 252 WP_001291964.1 hypothetical protein -
IHP09_RS24365 52111..52788 + 678 WP_001339397.1 IS66 family insertion sequence hypothetical protein -
IHP09_RS24370 52788..53135 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
IHP09_RS24375 53155..54726 + 1572 WP_000381395.1 IS66 family transposase -
IHP09_RS24380 55241..55450 + 210 WP_000062603.1 HEAT repeat domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..98997 98997


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T289625 WP_001387489.1 NZ_LR882058:50832-50984 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT289625 NZ_LR882058:c50782-50720 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References