Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 626042..626841 | Replicon | chromosome |
Accession | NZ_LR882057 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | IHP09_RS03125 | Protein ID | WP_000347267.1 |
Coordinates | 626042..626506 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | IHP09_RS03130 | Protein ID | WP_001307405.1 |
Coordinates | 626506..626841 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS03095 | 621043..621477 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
IHP09_RS03100 | 621495..622373 | - | 879 | WP_001298758.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
IHP09_RS03105 | 622363..623142 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
IHP09_RS03110 | 623153..623626 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
IHP09_RS03115 | 623649..624929 | - | 1281 | WP_000681947.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
IHP09_RS03120 | 625178..625987 | + | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
IHP09_RS03125 | 626042..626506 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
IHP09_RS03130 | 626506..626841 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
IHP09_RS03135 | 626990..628561 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
IHP09_RS03140 | 628936..630270 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
IHP09_RS03145 | 630286..631056 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T289605 WP_000347267.1 NZ_LR882057:c626506-626042 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |