Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 35382..35651 | Replicon | plasmid 4 |
Accession | NZ_LR882055 | ||
Organism | Escherichia coli isolate 2015-01-466 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | QREC_RS23205 | Protein ID | WP_001312861.1 |
Coordinates | 35493..35651 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 35382..35447 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QREC_RS23170 | 30384..30626 | + | 243 | WP_001365577.1 | hypothetical protein | - |
QREC_RS23175 | 31096..31623 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
QREC_RS23180 | 31679..31912 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
QREC_RS23185 | 31971..33994 | + | 2024 | Protein_46 | ParB/RepB/Spo0J family partition protein | - |
QREC_RS23190 | 34063..34497 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
QREC_RS23195 | 34494..35213 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 35225..35449 | + | 225 | NuclAT_0 | - | - |
- | 35225..35449 | + | 225 | NuclAT_0 | - | - |
- | 35225..35449 | + | 225 | NuclAT_0 | - | - |
- | 35225..35449 | + | 225 | NuclAT_0 | - | - |
- | 35225..35449 | - | 225 | NuclAT_0 | - | - |
QREC_RS23200 | 35234..35413 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 35382..35447 | + | 66 | NuclAT_1 | - | - |
QREC_RS23205 | 35493..35651 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
QREC_RS23210 | 35889..36266 | - | 378 | Protein_51 | hypothetical protein | - |
QREC_RS23215 | 36566..36862 | + | 297 | WP_001272251.1 | hypothetical protein | - |
QREC_RS23220 | 36973..37794 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
QREC_RS23225 | 38091..38693 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
QREC_RS23230 | 39016..39399 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
QREC_RS23235 | 39593..40264 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
QREC_RS23240 | 40401..40628 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | floR / lnu(F) / aadA2 / qnrS1 / catA1 | - | 1..50909 | 50909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T289601 WP_001312861.1 NZ_LR882055:35493-35651 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 66 bp
>AT289601 NZ_LR882055:c35447-35382 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|