Detailed information of TA system TA289601

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 35382..35651
• Replicon: plasmid 4
• Accession: NZ_LR882055
• Organism: Escherichia coli isolate 2015-01-466

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: QREC_RS23205
• Protein ID: WP_001312861.1
• Coordinates: 35493..35651 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	35382..35447 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QREC_RS23170	30384..30626	+	243	WP_001365577.1	hypothetical protein	-
QREC_RS23175	31096..31623	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
QREC_RS23180	31679..31912	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QREC_RS23185	31971..33994	+	2024	Protein_46	ParB/RepB/Spo0J family partition protein	-
QREC_RS23190	34063..34497	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QREC_RS23195	34494..35213	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	35225..35449	+	225	NuclAT_0	-	-
-	35225..35449	+	225	NuclAT_0	-	-
-	35225..35449	+	225	NuclAT_0	-	-
-	35225..35449	+	225	NuclAT_0	-	-
-	35225..35449	-	225	NuclAT_0	-	-
QREC_RS23200	35234..35413	-	180	WP_001309233.1	hypothetical protein	-
-	35382..35447	+	66	NuclAT_1	-	-
QREC_RS23205	35493..35651	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
QREC_RS23210	35889..36266	-	378	Protein_51	hypothetical protein	-
QREC_RS23215	36566..36862	+	297	WP_001272251.1	hypothetical protein	-
QREC_RS23220	36973..37794	+	822	WP_001234445.1	DUF945 domain-containing protein	-
QREC_RS23225	38091..38693	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
QREC_RS23230	39016..39399	+	384	WP_001354030.1	relaxosome protein TraM	-
QREC_RS23235	39593..40264	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
QREC_RS23240	40401..40628	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	floR / lnu(F) / aadA2 / qnrS1 / catA1	-	1..50909	50909

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T289601 WP_001312861.1 NZ_LR882055:35493-35651 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT289601 NZ_LR882055:c35447-35382 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin