Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 2077524..2078218 Replicon chromosome
Accession NZ_LR882050
Organism Escherichia coli isolate 2016-02-324

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag IHP20_RS10210 Protein ID WP_001263493.1
Coordinates 2077524..2077922 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag IHP20_RS10215 Protein ID WP_000554757.1
Coordinates 2077925..2078218 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHP20_RS10180 2072524..2073768 - 1245 WP_000189541.1 esterase FrsA -
- 2073184..2073264 - 81 NuclAT_10 - -
- 2073184..2073264 - 81 NuclAT_10 - -
- 2073184..2073264 - 81 NuclAT_10 - -
- 2073184..2073264 - 81 NuclAT_10 - -
IHP20_RS10185 2073860..2074318 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
IHP20_RS10190 2074579..2076036 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
IHP20_RS10195 2076093..2076614 - 522 Protein_1997 peptide chain release factor H -
IHP20_RS10200 2076613..2076816 - 204 Protein_1998 RNA ligase RtcB family protein -
IHP20_RS10205 2077062..2077514 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
IHP20_RS10210 2077524..2077922 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
IHP20_RS10215 2077925..2078218 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
IHP20_RS10220 2078270..2079325 - 1056 WP_001226164.1 DNA polymerase IV -
IHP20_RS10225 2079396..2080181 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
IHP20_RS10230 2080153..2081865 + 1713 Protein_2004 flagellar biosynthesis protein FlhA -
IHP20_RS10235 2082081..2082578 - 498 WP_000006261.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T289570 WP_001263493.1 NZ_LR882050:c2077922-2077524 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT289570 WP_000554757.1 NZ_LR882050:c2078218-2077925 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References