Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3688638..3689332 Replicon chromosome
Accession NZ_LR881940
Organism Escherichia coli isolate 2015-01-2097

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag IHP11_RS17875 Protein ID WP_001263493.1
Coordinates 3688638..3689036 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag IHP11_RS17880 Protein ID WP_000554757.1
Coordinates 3689039..3689332 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHP11_RS17845 3683638..3684882 - 1245 WP_000189541.1 esterase FrsA -
- 3684298..3684378 - 81 NuclAT_12 - -
- 3684298..3684378 - 81 NuclAT_12 - -
- 3684298..3684378 - 81 NuclAT_12 - -
- 3684298..3684378 - 81 NuclAT_12 - -
IHP11_RS17850 3684974..3685432 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
IHP11_RS17855 3685693..3687150 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
IHP11_RS17860 3687207..3687728 - 522 Protein_3495 peptide chain release factor H -
IHP11_RS17865 3687727..3687930 - 204 Protein_3496 RNA ligase RtcB family protein -
IHP11_RS17870 3688176..3688628 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
IHP11_RS17875 3688638..3689036 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
IHP11_RS17880 3689039..3689332 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
IHP11_RS17885 3689384..3690439 - 1056 WP_001226164.1 DNA polymerase IV -
IHP11_RS17890 3690510..3691295 - 786 WP_072132640.1 putative lateral flagellar export/assembly protein LafU -
IHP11_RS17895 3691267..3692979 + 1713 Protein_3502 flagellar biosynthesis protein FlhA -
IHP11_RS17900 3693195..3693692 - 498 WP_000006261.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T289551 WP_001263493.1 NZ_LR881940:c3689036-3688638 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT289551 WP_000554757.1 NZ_LR881940:c3689332-3689039 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References