Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3688638..3689332 | Replicon | chromosome |
| Accession | NZ_LR881940 | ||
| Organism | Escherichia coli isolate 2015-01-2097 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | IHP11_RS17875 | Protein ID | WP_001263493.1 |
| Coordinates | 3688638..3689036 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | IHP11_RS17880 | Protein ID | WP_000554757.1 |
| Coordinates | 3689039..3689332 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IHP11_RS17845 | 3683638..3684882 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3684298..3684378 | - | 81 | NuclAT_12 | - | - |
| - | 3684298..3684378 | - | 81 | NuclAT_12 | - | - |
| - | 3684298..3684378 | - | 81 | NuclAT_12 | - | - |
| - | 3684298..3684378 | - | 81 | NuclAT_12 | - | - |
| IHP11_RS17850 | 3684974..3685432 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| IHP11_RS17855 | 3685693..3687150 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| IHP11_RS17860 | 3687207..3687728 | - | 522 | Protein_3495 | peptide chain release factor H | - |
| IHP11_RS17865 | 3687727..3687930 | - | 204 | Protein_3496 | RNA ligase RtcB family protein | - |
| IHP11_RS17870 | 3688176..3688628 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| IHP11_RS17875 | 3688638..3689036 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| IHP11_RS17880 | 3689039..3689332 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| IHP11_RS17885 | 3689384..3690439 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| IHP11_RS17890 | 3690510..3691295 | - | 786 | WP_072132640.1 | putative lateral flagellar export/assembly protein LafU | - |
| IHP11_RS17895 | 3691267..3692979 | + | 1713 | Protein_3502 | flagellar biosynthesis protein FlhA | - |
| IHP11_RS17900 | 3693195..3693692 | - | 498 | WP_000006261.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T289551 WP_001263493.1 NZ_LR881940:c3689036-3688638 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|