Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 657412..658139 | Replicon | chromosome |
Accession | NZ_LR881940 | ||
Organism | Escherichia coli isolate 2015-01-2097 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | IHP11_RS03195 | Protein ID | WP_000550189.1 |
Coordinates | 657412..657726 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | IHP11_RS03200 | Protein ID | WP_191521707.1 |
Coordinates | 657723..658139 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP11_RS03175 | 653570..654556 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
IHP11_RS03180 | 654635..655327 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
IHP11_RS03185 | 655404..655907 | - | 504 | WP_001300832.1 | M48 family metallopeptidase | - |
IHP11_RS03190 | 655992..657128 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
IHP11_RS03195 | 657412..657726 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
IHP11_RS03200 | 657723..658139 | + | 417 | WP_191521707.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
IHP11_RS03205 | 658184..660202 | - | 2019 | WP_191521708.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
IHP11_RS03210 | 660628..662979 | - | 2352 | WP_000695488.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T289537 WP_000550189.1 NZ_LR881940:657412-657726 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT289537 WP_191521707.1 NZ_LR881940:657723-658139 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQVMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQVMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|