Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 614067..614866 | Replicon | chromosome |
Accession | NZ_LR881940 | ||
Organism | Escherichia coli isolate 2015-01-2097 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | IHP11_RS02975 | Protein ID | WP_000347251.1 |
Coordinates | 614067..614531 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | IHP11_RS02980 | Protein ID | WP_001307405.1 |
Coordinates | 614531..614866 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP11_RS02945 | 609068..609502 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
IHP11_RS02950 | 609520..610398 | - | 879 | WP_001300474.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
IHP11_RS02955 | 610388..611167 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
IHP11_RS02960 | 611178..611651 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
IHP11_RS02965 | 611674..612954 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
IHP11_RS02970 | 613203..614012 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
IHP11_RS02975 | 614067..614531 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
IHP11_RS02980 | 614531..614866 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
IHP11_RS02985 | 615015..616586 | - | 1572 | WP_191521705.1 | galactarate dehydratase | - |
IHP11_RS02990 | 616961..618295 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
IHP11_RS02995 | 618311..619081 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T289536 WP_000347251.1 NZ_LR881940:c614531-614067 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |