Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 2072704..2073206 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | U9YDH0 |
| Locus tag | IEU92_RS10250 | Protein ID | WP_000767829.1 |
| Coordinates | 2072704..2072958 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | S1Q063 |
| Locus tag | IEU92_RS10255 | Protein ID | WP_001259255.1 |
| Coordinates | 2072955..2073206 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS10220 | 2067719..2067946 | - | 228 | WP_000234896.1 | sulfurtransferase TusA | - |
| IEU92_RS10225 | 2067960..2069018 | - | 1059 | WP_000492339.1 | transport protein YeeE | - |
| IEU92_RS10230 | 2069197..2070555 | - | 1359 | WP_000019197.1 | putrescine/proton symporter PlaP | - |
| IEU92_RS10235 | 2070545..2070607 | - | 63 | WP_010723108.1 | membrane protein YoeI | - |
| IEU92_RS10240 | 2070822..2071751 | - | 930 | WP_000803351.1 | LysR family transcriptional regulator | - |
| IEU92_RS10245 | 2071797..2072621 | - | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
| IEU92_RS10250 | 2072704..2072958 | - | 255 | WP_000767829.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
| IEU92_RS10255 | 2072955..2073206 | - | 252 | WP_001259255.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| IEU92_RS10260 | 2073489..2073539 | + | 51 | WP_001364200.1 | his operon leader peptide | - |
| IEU92_RS10265 | 2073685..2074584 | + | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
| IEU92_RS10270 | 2074590..2075894 | + | 1305 | WP_000009594.1 | histidinol dehydrogenase | - |
| IEU92_RS10275 | 2075891..2076961 | + | 1071 | WP_000108941.1 | histidinol-phosphate transaminase | - |
| IEU92_RS10280 | 2076961..2078028 | + | 1068 | WP_000080105.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10183.58 Da Isoelectric Point: 8.0353
>T289520 WP_000767829.1 NZ_LR881938:c2072958-2072704 [Escherichia coli str. K-12 substr. MG1655]
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|