Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 252005..252699 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | IEU92_RS01180 | Protein ID | WP_001263489.1 |
| Coordinates | 252301..252699 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | IEU92_RS01175 | Protein ID | WP_000554758.1 |
| Coordinates | 252005..252298 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS01155 | 247637..248134 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| IEU92_RS01160 | 248358..250070 | - | 1713 | Protein_224 | flagellar biosynthesis protein FlhA | - |
| IEU92_RS01165 | 250042..250827 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| IEU92_RS01170 | 250898..251953 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| IEU92_RS01175 | 252005..252298 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| IEU92_RS01180 | 252301..252699 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| IEU92_RS01185 | 252709..253161 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| IEU92_RS01190 | 253479..253685 | + | 207 | Protein_230 | RtcB family protein | - |
| IEU92_RS01195 | 253681..254202 | + | 522 | Protein_231 | peptide chain release factor H | - |
| IEU92_RS01200 | 254259..255716 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| IEU92_RS01205 | 255977..256435 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - | 257031..257111 | + | 81 | NuclAT_12 | - | - |
| - | 257031..257111 | + | 81 | NuclAT_12 | - | - |
| - | 257031..257111 | + | 81 | NuclAT_12 | - | - |
| - | 257031..257111 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T289500 WP_001263489.1 NZ_LR881938:252301-252699 [Escherichia coli str. K-12 substr. MG1655]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |