Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 252005..252699 Replicon chromosome
Accession NZ_LR881938
Organism Escherichia coli str. K-12 substr. MG1655 strain K-12

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag IEU92_RS01180 Protein ID WP_001263489.1
Coordinates 252301..252699 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag IEU92_RS01175 Protein ID WP_000554758.1
Coordinates 252005..252298 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IEU92_RS01155 247637..248134 + 498 WP_000006255.1 REP-associated tyrosine transposase RayT -
IEU92_RS01160 248358..250070 - 1713 Protein_224 flagellar biosynthesis protein FlhA -
IEU92_RS01165 250042..250827 + 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
IEU92_RS01170 250898..251953 + 1056 WP_001226164.1 DNA polymerase IV -
IEU92_RS01175 252005..252298 + 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
IEU92_RS01180 252301..252699 + 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
IEU92_RS01185 252709..253161 + 453 WP_001059892.1 GNAT family N-acetyltransferase -
IEU92_RS01190 253479..253685 + 207 Protein_230 RtcB family protein -
IEU92_RS01195 253681..254202 + 522 Protein_231 peptide chain release factor H -
IEU92_RS01200 254259..255716 - 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
IEU92_RS01205 255977..256435 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- 257031..257111 + 81 NuclAT_12 - -
- 257031..257111 + 81 NuclAT_12 - -
- 257031..257111 + 81 NuclAT_12 - -
- 257031..257111 + 81 NuclAT_12 - -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T289500 WP_001263489.1 NZ_LR881938:252301-252699 [Escherichia coli str. K-12 substr. MG1655]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT289500 WP_000554758.1 NZ_LR881938:252005-252298 [Escherichia coli str. K-12 substr. MG1655]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References