Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 245961..246502 | Replicon | chromosome |
Accession | NZ_LR881938 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | Q47149 |
Locus tag | IEU92_RS01140 | Protein ID | WP_000615983.1 |
Coordinates | 245961..246239 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | Q47150 |
Locus tag | IEU92_RS01145 | Protein ID | WP_000729703.1 |
Coordinates | 246242..246502 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IEU92_RS01125 | 243543..244121 | + | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
IEU92_RS01130 | 244327..245094 | + | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
IEU92_RS01135 | 245065..245805 | - | 741 | WP_001225679.1 | murein L,D-transpeptidase | - |
IEU92_RS01140 | 245961..246239 | - | 279 | WP_000615983.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
IEU92_RS01145 | 246242..246502 | - | 261 | WP_000729703.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
IEU92_RS01150 | 246712..247461 | + | 750 | WP_000056849.1 | C40 family peptidase | - |
IEU92_RS01155 | 247637..248134 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
IEU92_RS01160 | 248358..250070 | - | 1713 | Protein_224 | flagellar biosynthesis protein FlhA | - |
IEU92_RS01165 | 250042..250827 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10846.62 Da Isoelectric Point: 9.9941
>T289499 WP_000615983.1 NZ_LR881938:c246239-245961 [Escherichia coli str. K-12 substr. MG1655]
MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4Q2U |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4Q2U | |
AlphaFold DB | A0A5F1F716 |