Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1269550..1270223 | Replicon | chromosome |
Accession | NZ_LR881936 | ||
Organism | Enterobacter cancerogenus strain UPC1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | ENTER_RS05995 | Protein ID | WP_101738092.1 |
Coordinates | 1269550..1269936 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | D2ZGH8 |
Locus tag | ENTER_RS06000 | Protein ID | WP_006177062.1 |
Coordinates | 1269939..1270223 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ENTER_RS05980 | 1265176..1266648 | - | 1473 | WP_202561810.1 | betaine-aldehyde dehydrogenase | - |
ENTER_RS05985 | 1266662..1267249 | - | 588 | WP_202561811.1 | transcriptional regulator BetI | - |
ENTER_RS05990 | 1267378..1269411 | + | 2034 | WP_202561812.1 | choline transporter | - |
ENTER_RS05995 | 1269550..1269936 | + | 387 | WP_101738092.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ENTER_RS06000 | 1269939..1270223 | + | 285 | WP_006177062.1 | helix-turn-helix domain-containing protein | Antitoxin |
ENTER_RS06005 | 1270459..1271370 | + | 912 | WP_202561813.1 | metal ABC transporter substrate-binding protein | - |
ENTER_RS06010 | 1271373..1272176 | + | 804 | WP_137271742.1 | iron/manganese ABC transporter ATP-binding protein SitB | - |
ENTER_RS06015 | 1272173..1273030 | + | 858 | WP_202561814.1 | metal ABC transporter permease | - |
ENTER_RS06020 | 1273027..1273866 | + | 840 | WP_006177066.1 | metal ABC transporter permease | - |
ENTER_RS06025 | 1273829..1274497 | - | 669 | WP_202561815.1 | enterobactin synthase subunit EntD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14346.53 Da Isoelectric Point: 9.7081
>T289492 WP_101738092.1 NZ_LR881936:1269550-1269936 [Enterobacter cancerogenus]
MSHALEFIETSLFTRQIKSIASDDELKDLQKELIAWPDKGDVIQHTGGLRKIRMAAGSKGKRGGARVIYFLATEEVIYLI
MAYPKNTKDTLTETEKAQLKKLTSVLRNTASNALDERCTMYPNQVRGG
MSHALEFIETSLFTRQIKSIASDDELKDLQKELIAWPDKGDVIQHTGGLRKIRMAAGSKGKRGGARVIYFLATEEVIYLI
MAYPKNTKDTLTETEKAQLKKLTSVLRNTASNALDERCTMYPNQVRGG
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|