Detailed information of TA system TA289464

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 62533..62959
• Replicon: plasmid 83_pKSR100
• Accession: NZ_LR878367
• Organism: Shigella flexneri 3a isolate 83

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: JMV05_RS24615
• Protein ID: WP_001372321.1
• Coordinates: 62533..62658 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	62735..62959 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMV05_RS24580 (57601)	57601..57828	-	228	WP_000589556.1	conjugal transfer relaxosome protein TraY	-
JMV05_RS24585 (57948)	57948..58595	-	648	WP_000332523.1	transcriptional regulator TraJ family protein	-
JMV05_RS24590 (58787)	58787..59170	-	384	WP_001151529.1	conjugal transfer relaxosome DNA-binding protein TraM	-
JMV05_RS24595 (59503)	59503..60093	+	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
JMV05_RS24600 (60390)	60390..61211	-	822	WP_001234445.1	DUF932 domain-containing protein	-
JMV05_RS24605 (61322)	61322..61618	-	297	WP_001272251.1	hypothetical protein	-
JMV05_RS24610 (61918)	61918..62214	+	297	Protein_77	hypothetical protein	-
JMV05_RS24615 (62533)	62533..62658	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
JMV05_RS24620 (62600)	62600..62749	-	150	Protein_79	plasmid maintenance protein Mok	-
JMV05_RS24625 (62771)	62771..62950	+	180	WP_001334662.1	hypothetical protein	-
- (62735)	62735..62959	-	225	NuclAT_0	-	Antitoxin
- (62735)	62735..62959	-	225	NuclAT_0	-	Antitoxin
- (62735)	62735..62959	-	225	NuclAT_0	-	Antitoxin
- (62735)	62735..62959	-	225	NuclAT_0	-	Antitoxin
JMV05_RS24630 (62928)	62928..63690	-	763	Protein_81	plasmid SOS inhibition protein A	-
JMV05_RS24635 (63687)	63687..64121	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
JMV05_RS24640 (64176)	64176..66134	-	1959	WP_152030379.1	ParB/RepB/Spo0J family partition protein	-
JMV05_RS24645 (66198)	66198..66431	-	234	WP_000005971.1	DUF905 domain-containing protein	-
JMV05_RS24650 (66487)	66487..67008	-	522	WP_033807850.1	single-stranded DNA-binding protein	-
JMV05_RS24655 (67307)	67307..67744	+	438	Protein_86	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	erm(B) / mph(A) / blaTEM-1B	-	1..72593	72593

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T289464 WP_001372321.1 NZ_LR878367:c62658-62533 [Shigella flexneri 3a]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT289464 NZ_LR878367:c62959-62735 [Shigella flexneri 3a]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin