Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 21054..21307 | Replicon | plasmid 83_pKSR100 |
| Accession | NZ_LR878367 | ||
| Organism | Shigella flexneri 3a isolate 83 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | JMV05_RS24360 | Protein ID | WP_001312851.1 |
| Coordinates | 21054..21203 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 21248..21307 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV05_RS24330 (17077) | 17077..17478 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| JMV05_RS24335 (17411) | 17411..17668 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| JMV05_RS24340 (17761) | 17761..18414 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| JMV05_RS24345 (19352) | 19352..20209 | - | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| JMV05_RS24350 (20202) | 20202..20276 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| JMV05_RS24355 (20521) | 20521..20769 | - | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| JMV05_RS24360 (21054) | 21054..21203 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (21248) | 21248..21307 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (21248) | 21248..21307 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (21248) | 21248..21307 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (21248) | 21248..21307 | + | 60 | NuclAT_1 | - | Antitoxin |
| JMV05_RS24365 (21450) | 21450..21923 | - | 474 | WP_016240489.1 | hypothetical protein | - |
| JMV05_RS24370 (22078) | 22078..22668 | - | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| JMV05_RS24375 (22706) | 22706..22915 | - | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| JMV05_RS24380 (22961) | 22961..23422 | - | 462 | WP_001233850.1 | thermonuclease family protein | - |
| JMV05_RS24385 (23668) | 23668..23880 | - | 213 | WP_001301409.1 | ANR family transcriptional regulator | - |
| JMV05_RS24390 (24012) | 24012..24572 | - | 561 | WP_033807966.1 | fertility inhibition protein FinO | - |
| JMV05_RS24395 (24627) | 24627..25373 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / mph(A) / blaTEM-1B | - | 1..72593 | 72593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T289460 WP_001312851.1 NZ_LR878367:c21203-21054 [Shigella flexneri 3a]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT289460 NZ_LR878367:21248-21307 [Shigella flexneri 3a]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
