Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3373391..3374009 | Replicon | chromosome |
| Accession | NZ_LR878365 | ||
| Organism | Shigella flexneri 3a isolate 83 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | JMV05_RS17225 | Protein ID | WP_001291435.1 |
| Coordinates | 3373791..3374009 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q0T7C3 |
| Locus tag | JMV05_RS17220 | Protein ID | WP_000344797.1 |
| Coordinates | 3373391..3373765 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV05_RS17210 (3368480) | 3368480..3369673 | + | 1194 | WP_024260158.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JMV05_RS17215 (3369696) | 3369696..3372845 | + | 3150 | WP_001132472.1 | efflux RND transporter permease AcrB | - |
| JMV05_RS17220 (3373391) | 3373391..3373765 | + | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
| JMV05_RS17225 (3373791) | 3373791..3374009 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| JMV05_RS17230 (3374181) | 3374181..3374732 | + | 552 | WP_000102569.1 | maltose O-acetyltransferase | - |
| JMV05_RS17235 (3374848) | 3374848..3375318 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| JMV05_RS17240 (3375482) | 3375482..3377032 | + | 1551 | WP_025758198.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| JMV05_RS17245 (3377074) | 3377074..3377427 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| JMV05_RS17255 (3377806) | 3377806..3378117 | + | 312 | WP_000409911.1 | MGMT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 3378147..3379475 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T289454 WP_001291435.1 NZ_LR878365:3373791-3374009 [Shigella flexneri 3a]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT289454 WP_000344797.1 NZ_LR878365:3373391-3373765 [Shigella flexneri 3a]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPD8 |