Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2278231..2278456 Replicon chromosome
Accession NZ_LR878365
Organism Shigella flexneri 3a isolate 83

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag JMV05_RS11475 Protein ID WP_000813254.1
Coordinates 2278231..2278386 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2278398..2278456 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV05_RS11445 2273490..2273855 + 366 WP_000124119.1 hypothetical protein -
JMV05_RS11450 2273855..2275042 + 1188 Protein_2238 IS91 family transposase -
JMV05_RS11455 2275454..2276008 - 555 WP_000640143.1 DUF1133 family protein -
JMV05_RS11460 2276005..2276295 - 291 WP_000228038.1 DUF1364 domain-containing protein -
JMV05_RS11465 2276295..2276894 - 600 WP_000940329.1 DUF1367 family protein -
JMV05_RS11470 2277028..2277725 + 698 WP_225620296.1 IS1 family transposase -
JMV05_RS11475 2278231..2278386 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2278398..2278456 + 59 - - Antitoxin
JMV05_RS11480 2278841..2279206 - 366 WP_000610655.1 DUF551 domain-containing protein -
JMV05_RS11485 2279206..2279871 - 666 WP_005115317.1 hypothetical protein -
JMV05_RS11490 2279871..2280233 - 363 Protein_2246 HNH endonuclease -
JMV05_RS11495 2280235..2280453 - 219 WP_000256997.1 DUF4014 family protein -
JMV05_RS11500 2280546..2280902 - 357 WP_000403784.1 hypothetical protein -
JMV05_RS11505 2280960..2281382 - 423 WP_001118171.1 DUF977 family protein -
JMV05_RS11510 2281397..2282143 - 747 WP_000788996.1 ATP-binding protein -
JMV05_RS11515 2282289..2282458 - 170 Protein_2251 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2270151..2296510 26359


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T289450 WP_000813254.1 NZ_LR878365:c2278386-2278231 [Shigella flexneri 3a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT289450 NZ_LR878365:2278398-2278456 [Shigella flexneri 3a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References