Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1017176..1017903 | Replicon | chromosome |
| Accession | NZ_LR878365 | ||
| Organism | Shigella flexneri 3a isolate 83 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2Y4XNA6 |
| Locus tag | JMV05_RS05005 | Protein ID | WP_000547562.1 |
| Coordinates | 1017176..1017487 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMV05_RS05010 | Protein ID | WP_000126288.1 |
| Coordinates | 1017484..1017903 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV05_RS04975 (1012334) | 1012334..1014019 | + | 1686 | WP_025758592.1 | formate hydrogenlyase subunit HycE | - |
| JMV05_RS04980 (1014029) | 1014029..1014571 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| JMV05_RS04985 (1014571) | 1014571..1015338 | + | 768 | WP_025758590.1 | formate hydrogenlyase subunit HycG | - |
| JMV05_RS04990 (1015335) | 1015335..1015745 | + | 411 | WP_001291916.1 | formate hydrogenlyase assembly protein HycH | - |
| JMV05_RS04995 (1015738) | 1015738..1016208 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| JMV05_RS05000 (1016260) | 1016260..1017003 | + | 744 | WP_024259998.1 | hypothetical protein | - |
| JMV05_RS05005 (1017176) | 1017176..1017487 | + | 312 | WP_000547562.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| JMV05_RS05010 (1017484) | 1017484..1017903 | + | 420 | WP_000126288.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMV05_RS05015 (1018018) | 1018018..1019442 | - | 1425 | WP_119182051.1 | 6-phospho-beta-glucosidase AscB | - |
| JMV05_RS05020 (1019451) | 1019451..1020908 | - | 1458 | WP_001107865.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| JMV05_RS05025 (1021168) | 1021168..1022178 | + | 1011 | WP_005051459.1 | DNA-binding transcriptional regulator AscG | - |
| JMV05_RS05030 (1022327) | 1022327..1022854 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12298.98 Da Isoelectric Point: 9.4924
>T289444 WP_000547562.1 NZ_LR878365:1017176-1017487 [Shigella flexneri 3a]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLGVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLGVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15397.33 Da Isoelectric Point: 4.3648
>AT289444 WP_000126288.1 NZ_LR878365:1017484-1017903 [Shigella flexneri 3a]
MTANAAHAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAAHAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|