Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-VapI
Location 3636321..3636836 Replicon chromosome
Accession NZ_LR828257
Organism Xanthomonas hortorum pv. vitians strain CFBP 498

Toxin (Protein)


Gene name higB Uniprot ID A0A1L5Y3A2
Locus tag CFBP8129_RS16020 Protein ID WP_006450902.1
Coordinates 3636630..3636836 (-) Length 69 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A6V7E8T8
Locus tag CFBP8129_RS16015 Protein ID WP_074057535.1
Coordinates 3636321..3636620 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFBP8129_RS15990 3631795..3632679 + 885 WP_006451802.1 MinD/ParA family protein -
CFBP8129_RS15995 3632676..3633449 + 774 WP_023903918.1 RNA polymerase sigma factor FliA -
CFBP8129_RS16000 3633485..3633877 + 393 WP_002813536.1 chemotaxis response regulator CheY -
CFBP8129_RS16005 3633877..3634503 + 627 WP_006450905.1 protein phosphatase CheZ -
CFBP8129_RS16010 3634506..3636164 + 1659 WP_055826896.1 chemotaxis protein CheA -
CFBP8129_RS16015 3636321..3636620 - 300 WP_074057535.1 HigA family addiction module antidote protein Antitoxin
CFBP8129_RS16020 3636630..3636836 - 207 WP_006450902.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
CFBP8129_RS16025 3637748..3638488 + 741 WP_006452732.1 flagellar motor protein -
CFBP8129_RS16030 3638496..3639485 + 990 WP_006452731.1 flagellar motor protein MotD -
CFBP8129_RS16035 3639487..3640269 + 783 WP_006452730.1 ParA family protein -
CFBP8129_RS16040 3640266..3641516 + 1251 WP_074057536.1 chemotaxis protein CheW -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(3-68)

Antitoxin

Cro/C1-type helix-turn-helix domain

(22-67)


Sequences

Toxin        


Download         Length: 69 a.a.        Molecular weight: 7818.83 Da        Isoelectric Point: 6.2041

>T289431 WP_006450902.1 NZ_LR828257:c3636836-3636630 [Xanthomonas hortorum pv. vitians]
MQAVAERKLQLLDSAQTLEFLRSPPGNRFELLAGTRAGQHSIRINDQWRVCFVWTDAGPEHVEIVDYH

Download         Length: 207 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10900.54 Da        Isoelectric Point: 10.7753

>AT289431 WP_074057535.1 NZ_LR828257:c3636620-3636321 [Xanthomonas hortorum pv. vitians]
MRPNNKLRAIHPGEILREDFMLPLGLTINGLARALDVPATRIHSIVHGERAISADTAARLARHFGGDAASWLALQATYEL
KTLPNRSEIERNVQPRVAA

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1L5Y3A2

Antitoxin

Source ID Structure
AlphaFold DB A0A6V7E8T8

References