Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 914479..915068 | Replicon | chromosome |
| Accession | NZ_LR828257 | ||
| Organism | Xanthomonas hortorum pv. vitians strain CFBP 498 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | A0A6V7BZM8 |
| Locus tag | CFBP8129_RS03830 | Protein ID | WP_074058684.1 |
| Coordinates | 914479..914760 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0Q5FN17 |
| Locus tag | CFBP8129_RS03835 | Protein ID | WP_055829449.1 |
| Coordinates | 914778..915068 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP8129_RS03820 | 910827..913070 | + | 2244 | WP_183153053.1 | exodeoxyribonuclease V subunit alpha | - |
| CFBP8129_RS03825 | 913209..914264 | + | 1056 | WP_074058685.1 | virulence RhuM family protein | - |
| CFBP8129_RS03830 | 914479..914760 | + | 282 | WP_074058684.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CFBP8129_RS03835 | 914778..915068 | + | 291 | WP_055829449.1 | HigA family addiction module antidote protein | Antitoxin |
| CFBP8129_RS03840 | 915191..915934 | - | 744 | WP_074058683.1 | SDR family oxidoreductase | - |
| CFBP8129_RS03845 | 916153..916971 | + | 819 | WP_197970278.1 | AraC family transcriptional regulator | - |
| CFBP8129_RS03850 | 917589..917921 | - | 333 | WP_074058681.1 | hypothetical protein | - |
| CFBP8129_RS03855 | 918314..918592 | - | 279 | WP_180313725.1 | hypothetical protein | - |
| CFBP8129_RS03860 | 918715..919644 | - | 930 | WP_180313726.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11031.71 Da Isoelectric Point: 10.2121
>T289428 WP_074058684.1 NZ_LR828257:914479-914760 [Xanthomonas hortorum pv. vitians]
MIRSFVDKEAEKIWLGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVAEVDIVDYH
MIRSFVDKEAEKIWLGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVAEVDIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6V7BZM8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q5FN17 |