Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5084148..5084737 | Replicon | chromosome |
Accession | NZ_LR828253 | ||
Organism | Xanthomonas hortorum pv. gardneri strain CFBP 8129 |
Toxin (Protein)
Gene name | graT | Uniprot ID | F0C464 |
Locus tag | CFBP498_RS21750 | Protein ID | WP_006449988.1 |
Coordinates | 5084456..5084737 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CFBP498_RS21745 | Protein ID | WP_006449989.1 |
Coordinates | 5084148..5084438 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP498_RS21730 (CFBP8129_44310) | 5079849..5080829 | + | 981 | WP_074065938.1 | IS5 family transposase | - |
CFBP498_RS21735 (CFBP8129_44320) | 5081045..5082640 | - | 1596 | WP_006449992.1 | anti-phage dCTP deaminase | - |
CFBP498_RS21740 (CFBP8129_44330) | 5083282..5083614 | + | 333 | WP_006449991.1 | hypothetical protein | - |
CFBP498_RS23870 | 5083767..5083957 | + | 191 | Protein_4273 | hypothetical protein | - |
CFBP498_RS21745 (CFBP8129_44350) | 5084148..5084438 | - | 291 | WP_006449989.1 | HigA family addiction module antitoxin | Antitoxin |
CFBP498_RS21750 (CFBP8129_44360) | 5084456..5084737 | - | 282 | WP_006449988.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP498_RS21755 (CFBP8129_44370) | 5084951..5086006 | - | 1056 | WP_006449987.1 | virulence RhuM family protein | - |
CFBP498_RS21760 (CFBP8129_44380) | 5086217..5088367 | - | 2151 | WP_228996014.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 5079849..5080829 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11044.69 Da Isoelectric Point: 9.7972
>T289427 WP_006449988.1 NZ_LR828253:c5084737-5084456 [Xanthomonas hortorum pv. gardneri]
VIRSFIDKEAEKIWLGERSRRLPSDIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
VIRSFIDKEAEKIWLGERSRRLPSDIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|