Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2786781..2787204 Replicon chromosome
Accession NZ_LR822061
Organism Staphylococcus aureus isolate HU-14

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag BKMNNEJI_RS13985 Protein ID WP_001065079.1
Coordinates 2786781..2787017 (+) Length 79 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag BKMNNEJI_RS13990 Protein ID WP_000028421.1
Coordinates 2787022..2787204 (+) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKMNNEJI_RS13920 2781930..2782700 + 771 WP_000190254.1 conserved phage C-terminal domain-containing protein -
BKMNNEJI_RS13925 2782710..2783489 + 780 WP_000803062.1 ATP-binding protein -
BKMNNEJI_RS13930 2783483..2783641 + 159 WP_000256589.1 hypothetical protein -
BKMNNEJI_RS13935 2783654..2783875 + 222 WP_001123695.1 DUF3269 family protein -
BKMNNEJI_RS13940 2783885..2784289 + 405 WP_000049793.1 DUF1064 domain-containing protein -
BKMNNEJI_RS13945 2784294..2784479 + 186 WP_001187243.1 DUF3113 family protein -
BKMNNEJI_RS13950 2784480..2784785 + 306 WP_000101252.1 hypothetical protein -
BKMNNEJI_RS13955 2784913..2785269 + 357 WP_000029376.1 hypothetical protein -
BKMNNEJI_RS13960 2785273..2785515 + 243 WP_000131389.1 hypothetical protein -
BKMNNEJI_RS13965 2785529..2785735 + 207 WP_000693987.1 hypothetical protein -
BKMNNEJI_RS13970 2785738..2786139 + 402 WP_000695759.1 hypothetical protein -
BKMNNEJI_RS13975 2786136..2786483 + 348 WP_000979209.1 hypothetical protein -
BKMNNEJI_RS13980 2786480..2786788 + 309 WP_000144708.1 hypothetical protein -
BKMNNEJI_RS13985 2786781..2787017 + 237 WP_001065079.1 DUF1024 family protein Toxin
BKMNNEJI_RS13990 2787022..2787204 + 183 WP_000028421.1 hypothetical protein Antitoxin
BKMNNEJI_RS13995 2787197..2787727 + 531 WP_000185651.1 dUTP pyrophosphatase -
BKMNNEJI_RS14000 2787764..2787970 + 207 WP_000195785.1 DUF1381 domain-containing protein -
BKMNNEJI_RS14005 2787967..2788161 + 195 WP_000132920.1 hypothetical protein -
BKMNNEJI_RS14010 2788158..2788361 + 204 WP_001072797.1 hypothetical protein -
BKMNNEJI_RS14015 2788354..2788527 + 174 WP_001657250.1 transcriptional activator RinB -
BKMNNEJI_RS14020 2788528..2788674 + 147 WP_000990005.1 hypothetical protein -
BKMNNEJI_RS14025 2788698..2789120 + 423 WP_000162701.1 RinA family phage transcriptional activator -
BKMNNEJI_RS14030 2789308..2789802 + 495 WP_001038244.1 terminase small subunit -
BKMNNEJI_RS14035 2789805..2791100 + 1296 WP_000273011.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2771295..2816241 44946


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-78)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 79 a.a.        Molecular weight: 8725.64 Da        Isoelectric Point: 3.9302

>T289422 WP_001065079.1 NZ_LR822061:2786781-2787017 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEE

Download         Length: 237 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6683.59 Da        Isoelectric Point: 4.3791

>AT289422 WP_000028421.1 NZ_LR822061:2787022-2787204 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References