Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2767950..2768166 | Replicon | chromosome |
Accession | NZ_LR822061 | ||
Organism | Staphylococcus aureus isolate HU-14 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | BKMNNEJI_RS13805 | Protein ID | WP_001802298.1 |
Coordinates | 2767950..2768054 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2768111..2768166 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BKMNNEJI_RS13790 | 2764747..2765529 | + | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
BKMNNEJI_RS13795 | 2765597..2766454 | + | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
BKMNNEJI_RS13800 | 2767112..2767270 | - | 159 | WP_001792784.1 | hypothetical protein | - |
BKMNNEJI_RS13805 | 2767950..2768054 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2768111..2768166 | - | 56 | - | - | Antitoxin |
BKMNNEJI_RS13810 | 2768487..2769578 | - | 1092 | WP_000495669.1 | hypothetical protein | - |
BKMNNEJI_RS13815 | 2769844..2770821 | - | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
BKMNNEJI_RS13820 | 2770823..2771143 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
BKMNNEJI_RS13825 | 2771295..2771960 | + | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T289421 WP_001802298.1 NZ_LR822061:2767950-2768054 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT289421 NZ_LR822061:c2768166-2768111 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|