Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2482914..2483098 | Replicon | chromosome |
Accession | NZ_LR822061 | ||
Organism | Staphylococcus aureus isolate HU-14 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | BKMNNEJI_RS12330 | Protein ID | WP_000482652.1 |
Coordinates | 2482914..2483021 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2483038..2483098 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BKMNNEJI_RS12305 | 2478276..2478749 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
BKMNNEJI_RS12310 | 2478872..2480083 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
BKMNNEJI_RS12315 | 2480265..2480924 | - | 660 | WP_000831302.1 | hypothetical protein | - |
BKMNNEJI_RS12320 | 2480984..2482126 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
BKMNNEJI_RS12325 | 2482394..2482780 | + | 387 | WP_000779360.1 | flippase GtxA | - |
BKMNNEJI_RS12330 | 2482914..2483021 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2483038..2483098 | - | 61 | - | - | Antitoxin |
BKMNNEJI_RS12335 | 2483724..2485487 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
BKMNNEJI_RS12340 | 2485512..2487245 | + | 1734 | WP_000486483.1 | ABC transporter ATP-binding protein/permease | - |
BKMNNEJI_RS12345 | 2487476..2487643 | + | 168 | Protein_2400 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T289416 WP_000482652.1 NZ_LR822061:2482914-2483021 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT289416 NZ_LR822061:c2483098-2483038 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|