Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1004370..1004793 Replicon chromosome
Accession NZ_LR822061
Organism Staphylococcus aureus isolate HU-14

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag BKMNNEJI_RS05105 Protein ID WP_001065079.1
Coordinates 1004557..1004793 (-) Length 79 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag BKMNNEJI_RS05100 Protein ID WP_000028421.1
Coordinates 1004370..1004552 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKMNNEJI_RS05060 1000582..1001805 - 1224 WP_031783646.1 PBSX family phage terminase large subunit -
BKMNNEJI_RS05065 1001798..1002292 - 495 WP_000594079.1 terminase -
BKMNNEJI_RS05070 1002645..1003046 - 402 WP_031782919.1 hypothetical protein -
BKMNNEJI_RS05075 1003047..1003220 - 174 WP_031783103.1 transcriptional activator RinB -
BKMNNEJI_RS05080 1003213..1003416 - 204 WP_001072797.1 hypothetical protein -
BKMNNEJI_RS05085 1003413..1003607 - 195 WP_000132920.1 hypothetical protein -
BKMNNEJI_RS05090 1003604..1003810 - 207 WP_000195785.1 DUF1381 domain-containing protein -
BKMNNEJI_RS05095 1003847..1004377 - 531 WP_000185651.1 dUTP pyrophosphatase -
BKMNNEJI_RS05100 1004370..1004552 - 183 WP_000028421.1 hypothetical protein Antitoxin
BKMNNEJI_RS05105 1004557..1004793 - 237 WP_001065079.1 DUF1024 family protein Toxin
BKMNNEJI_RS05110 1004786..1005094 - 309 WP_000144708.1 hypothetical protein -
BKMNNEJI_RS05115 1005091..1005438 - 348 WP_000979209.1 hypothetical protein -
BKMNNEJI_RS05120 1005435..1005836 - 402 WP_000695759.1 hypothetical protein -
BKMNNEJI_RS05125 1005849..1006097 - 249 WP_072466103.1 hypothetical protein -
BKMNNEJI_RS05130 1006097..1006351 - 255 WP_000022736.1 DUF3310 domain-containing protein -
BKMNNEJI_RS05135 1006351..1006497 - 147 Protein_984 hypothetical protein -
BKMNNEJI_RS05140 1006544..1006729 - 186 WP_031783102.1 DUF3113 family protein -
BKMNNEJI_RS05145 1006729..1007136 - 408 WP_000401950.1 RusA family crossover junction endodeoxyribonuclease -
BKMNNEJI_RS05150 1007146..1007367 - 222 WP_001123688.1 DUF3269 family protein -
BKMNNEJI_RS05155 1007371..1007586 - 216 WP_001024405.1 hypothetical protein -
BKMNNEJI_RS05160 1007583..1008824 - 1242 WP_015445891.1 AAA family ATPase -
BKMNNEJI_RS05165 1008821..1009177 - 357 WP_001132243.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 976585..1020206 43621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-78)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 79 a.a.        Molecular weight: 8725.64 Da        Isoelectric Point: 3.9302

>T289413 WP_001065079.1 NZ_LR822061:c1004793-1004557 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEE

Download         Length: 237 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6683.59 Da        Isoelectric Point: 4.3791

>AT289413 WP_000028421.1 NZ_LR822061:c1004552-1004370 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References