Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 516140..516563 Replicon chromosome
Accession NZ_LR822061
Organism Staphylococcus aureus isolate HU-14

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag BKMNNEJI_RS02840 Protein ID WP_001065079.1
Coordinates 516140..516376 (+) Length 79 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag BKMNNEJI_RS02845 Protein ID WP_000028421.1
Coordinates 516381..516563 (+) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKMNNEJI_RS02790 511606..513558 + 1953 WP_078065799.1 DNA polymerase -
BKMNNEJI_RS02795 513571..513756 + 186 WP_001164629.1 DUF3113 family protein -
BKMNNEJI_RS02800 513756..514157 + 402 WP_000113981.1 PVL family protein -
BKMNNEJI_RS02805 514157..514414 + 258 WP_000111488.1 DUF3310 domain-containing protein -
BKMNNEJI_RS02810 514417..514617 + 201 WP_000235381.1 hypothetical protein -
BKMNNEJI_RS02815 514626..514874 + 249 WP_015968801.1 phi PVL orf 51-like protein -
BKMNNEJI_RS02820 514888..515094 + 207 WP_000693987.1 hypothetical protein -
BKMNNEJI_RS02825 515097..515498 + 402 WP_000695759.1 hypothetical protein -
BKMNNEJI_RS02830 515495..515842 + 348 WP_000979209.1 hypothetical protein -
BKMNNEJI_RS02835 515839..516147 + 309 WP_000144708.1 hypothetical protein -
BKMNNEJI_RS02840 516140..516376 + 237 WP_001065079.1 DUF1024 family protein Toxin
BKMNNEJI_RS02845 516381..516563 + 183 WP_000028421.1 hypothetical protein Antitoxin
BKMNNEJI_RS02850 516556..517086 + 531 WP_000185651.1 dUTP pyrophosphatase -
BKMNNEJI_RS02855 517123..517329 + 207 WP_000195785.1 DUF1381 domain-containing protein -
BKMNNEJI_RS02860 517326..517520 + 195 WP_000132920.1 hypothetical protein -
BKMNNEJI_RS02865 517517..517720 + 204 WP_001072797.1 hypothetical protein -
BKMNNEJI_RS02870 517713..517865 + 153 WP_031767608.1 transcriptional activator RinB -
BKMNNEJI_RS02875 517933..518133 + 201 WP_000265258.1 DUF1514 family protein -
BKMNNEJI_RS02880 518185..520632 + 2448 WP_031765980.1 virulence-associated E family protein -
BKMNNEJI_RS02885 520735..520839 - 105 WP_015978074.1 hypothetical protein -
BKMNNEJI_RS02890 520973..521263 + 291 WP_000665204.1 VRR-NUC domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-78)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 79 a.a.        Molecular weight: 8725.64 Da        Isoelectric Point: 3.9302

>T289412 WP_001065079.1 NZ_LR822061:516140-516376 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEE

Download         Length: 237 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6683.59 Da        Isoelectric Point: 4.3791

>AT289412 WP_000028421.1 NZ_LR822061:516381-516563 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References