Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2785446..2785869 Replicon chromosome
Accession NZ_LR822060
Organism Staphylococcus aureus isolate P3.1

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag LJDFIFNA_RS14005 Protein ID WP_001065079.1
Coordinates 2785446..2785682 (+) Length 79 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LJDFIFNA_RS14010 Protein ID WP_000028421.1
Coordinates 2785687..2785869 (+) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJDFIFNA_RS13940 2780595..2781365 + 771 WP_000190254.1 conserved phage C-terminal domain-containing protein -
LJDFIFNA_RS13945 2781375..2782154 + 780 WP_000803062.1 ATP-binding protein -
LJDFIFNA_RS13950 2782148..2782306 + 159 WP_000256589.1 hypothetical protein -
LJDFIFNA_RS13955 2782319..2782540 + 222 WP_001123695.1 DUF3269 family protein -
LJDFIFNA_RS13960 2782550..2782954 + 405 WP_000049793.1 DUF1064 domain-containing protein -
LJDFIFNA_RS13965 2782959..2783144 + 186 WP_001187243.1 DUF3113 family protein -
LJDFIFNA_RS13970 2783145..2783450 + 306 WP_000101252.1 hypothetical protein -
LJDFIFNA_RS13975 2783578..2783934 + 357 WP_000029376.1 hypothetical protein -
LJDFIFNA_RS13980 2783938..2784180 + 243 WP_000131389.1 hypothetical protein -
LJDFIFNA_RS13985 2784194..2784400 + 207 WP_000693987.1 hypothetical protein -
LJDFIFNA_RS13990 2784403..2784804 + 402 WP_000695759.1 hypothetical protein -
LJDFIFNA_RS13995 2784801..2785148 + 348 WP_000979209.1 hypothetical protein -
LJDFIFNA_RS14000 2785145..2785453 + 309 WP_000144708.1 hypothetical protein -
LJDFIFNA_RS14005 2785446..2785682 + 237 WP_001065079.1 DUF1024 family protein Toxin
LJDFIFNA_RS14010 2785687..2785869 + 183 WP_000028421.1 hypothetical protein Antitoxin
LJDFIFNA_RS14015 2785862..2786392 + 531 WP_000185651.1 dUTP pyrophosphatase -
LJDFIFNA_RS14020 2786429..2786635 + 207 WP_000195785.1 DUF1381 domain-containing protein -
LJDFIFNA_RS14025 2786632..2786826 + 195 WP_000132920.1 hypothetical protein -
LJDFIFNA_RS14030 2786823..2787026 + 204 WP_001072797.1 hypothetical protein -
LJDFIFNA_RS14035 2787019..2787192 + 174 WP_001657250.1 transcriptional activator RinB -
LJDFIFNA_RS14040 2787193..2787339 + 147 WP_000990005.1 hypothetical protein -
LJDFIFNA_RS14045 2787363..2787785 + 423 WP_000162701.1 RinA family phage transcriptional activator -
LJDFIFNA_RS14050 2787973..2788467 + 495 WP_001038244.1 terminase small subunit -
LJDFIFNA_RS14055 2788470..2789765 + 1296 WP_000273011.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2769960..2814906 44946


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-78)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 79 a.a.        Molecular weight: 8725.64 Da        Isoelectric Point: 3.9302

>T289402 WP_001065079.1 NZ_LR822060:2785446-2785682 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEE

Download         Length: 237 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6683.59 Da        Isoelectric Point: 4.3791

>AT289402 WP_000028421.1 NZ_LR822060:2785687-2785869 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References