Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2766615..2766831 | Replicon | chromosome |
| Accession | NZ_LR822060 | ||
| Organism | Staphylococcus aureus isolate P3.1 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | LJDFIFNA_RS13820 | Protein ID | WP_001802298.1 |
| Coordinates | 2766615..2766719 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2766776..2766831 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJDFIFNA_RS13805 | 2763412..2764194 | + | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
| LJDFIFNA_RS13810 | 2764262..2765119 | + | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
| LJDFIFNA_RS13815 | 2765777..2765935 | - | 159 | WP_001792784.1 | hypothetical protein | - |
| LJDFIFNA_RS13820 | 2766615..2766719 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| LJDFIFNA_RS13825 | 2767152..2768243 | - | 1092 | WP_000495669.1 | hypothetical protein | - |
| LJDFIFNA_RS13830 | 2768509..2769486 | - | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
| LJDFIFNA_RS13835 | 2769488..2769808 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| LJDFIFNA_RS13840 | 2769960..2770625 | + | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T289401 WP_001802298.1 NZ_LR822060:2766615-2766719 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT289401 NZ_LR822060:c2766831-2766776 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|