Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2481579..2481763 | Replicon | chromosome |
| Accession | NZ_LR822060 | ||
| Organism | Staphylococcus aureus isolate P3.1 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
| Locus tag | LJDFIFNA_RS12335 | Protein ID | WP_000482652.1 |
| Coordinates | 2481579..2481686 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2481703..2481763 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJDFIFNA_RS12310 | 2476941..2477414 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
| LJDFIFNA_RS12315 | 2477537..2478748 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| LJDFIFNA_RS12320 | 2478930..2479589 | - | 660 | WP_000831302.1 | hypothetical protein | - |
| LJDFIFNA_RS12325 | 2479649..2480791 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
| LJDFIFNA_RS12330 | 2481059..2481445 | + | 387 | WP_000779360.1 | flippase GtxA | - |
| LJDFIFNA_RS12335 | 2481579..2481686 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2481703..2481763 | - | 61 | - | - | Antitoxin |
| LJDFIFNA_RS12340 | 2482389..2484152 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
| LJDFIFNA_RS12345 | 2484177..2485910 | + | 1734 | WP_000486483.1 | ABC transporter ATP-binding protein/permease | - |
| LJDFIFNA_RS12350 | 2486141..2486308 | + | 168 | Protein_2401 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T289396 WP_000482652.1 NZ_LR822060:2481579-2481686 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT289396 NZ_LR822060:c2481763-2481703 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|