Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1003032..1003455 Replicon chromosome
Accession NZ_LR822060
Organism Staphylococcus aureus isolate P3.1

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag LJDFIFNA_RS05100 Protein ID WP_001065079.1
Coordinates 1003219..1003455 (-) Length 79 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LJDFIFNA_RS05095 Protein ID WP_000028421.1
Coordinates 1003032..1003214 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJDFIFNA_RS05055 999244..1000467 - 1224 WP_031783646.1 PBSX family phage terminase large subunit -
LJDFIFNA_RS05060 1000460..1000954 - 495 WP_000594079.1 terminase -
LJDFIFNA_RS05065 1001307..1001708 - 402 WP_031782919.1 hypothetical protein -
LJDFIFNA_RS05070 1001709..1001882 - 174 WP_031783103.1 transcriptional activator RinB -
LJDFIFNA_RS05075 1001875..1002078 - 204 WP_001072797.1 hypothetical protein -
LJDFIFNA_RS05080 1002075..1002269 - 195 WP_000132920.1 hypothetical protein -
LJDFIFNA_RS05085 1002266..1002472 - 207 WP_000195785.1 DUF1381 domain-containing protein -
LJDFIFNA_RS05090 1002509..1003039 - 531 WP_000185651.1 dUTP pyrophosphatase -
LJDFIFNA_RS05095 1003032..1003214 - 183 WP_000028421.1 hypothetical protein Antitoxin
LJDFIFNA_RS05100 1003219..1003455 - 237 WP_001065079.1 DUF1024 family protein Toxin
LJDFIFNA_RS05105 1003448..1003756 - 309 WP_000144708.1 hypothetical protein -
LJDFIFNA_RS05110 1003753..1004100 - 348 WP_000979209.1 hypothetical protein -
LJDFIFNA_RS05115 1004097..1004501 - 405 WP_020444668.1 hypothetical protein -
LJDFIFNA_RS05120 1004514..1004762 - 249 WP_072466103.1 hypothetical protein -
LJDFIFNA_RS05125 1004762..1005016 - 255 WP_000022736.1 DUF3310 domain-containing protein -
LJDFIFNA_RS05130 1005016..1005162 - 147 Protein_983 hypothetical protein -
LJDFIFNA_RS05135 1005209..1005394 - 186 WP_031783102.1 DUF3113 family protein -
LJDFIFNA_RS05140 1005394..1005801 - 408 WP_000401950.1 RusA family crossover junction endodeoxyribonuclease -
LJDFIFNA_RS05145 1005811..1006032 - 222 WP_001123688.1 DUF3269 family protein -
LJDFIFNA_RS05150 1006036..1006251 - 216 WP_001024405.1 hypothetical protein -
LJDFIFNA_RS05155 1006248..1007489 - 1242 WP_015445891.1 AAA family ATPase -
LJDFIFNA_RS05160 1007486..1007842 - 357 WP_001132243.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 975253..1020137 44884


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-78)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 79 a.a.        Molecular weight: 8725.64 Da        Isoelectric Point: 3.9302

>T289393 WP_001065079.1 NZ_LR822060:c1003455-1003219 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEE

Download         Length: 237 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6683.59 Da        Isoelectric Point: 4.3791

>AT289393 WP_000028421.1 NZ_LR822060:c1003214-1003032 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References