Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 514808..515231 Replicon chromosome
Accession NZ_LR822060
Organism Staphylococcus aureus isolate P3.1

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag LJDFIFNA_RS02835 Protein ID WP_001065079.1
Coordinates 514808..515044 (+) Length 79 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LJDFIFNA_RS02840 Protein ID WP_000028421.1
Coordinates 515049..515231 (+) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJDFIFNA_RS02785 510274..512226 + 1953 WP_078065799.1 DNA polymerase -
LJDFIFNA_RS02790 512239..512424 + 186 WP_001164629.1 DUF3113 family protein -
LJDFIFNA_RS02795 512424..512825 + 402 WP_000113981.1 PVL family protein -
LJDFIFNA_RS02800 512825..513082 + 258 WP_000111488.1 DUF3310 domain-containing protein -
LJDFIFNA_RS02805 513085..513285 + 201 WP_000235381.1 hypothetical protein -
LJDFIFNA_RS02810 513294..513542 + 249 WP_015968801.1 phi PVL orf 51-like protein -
LJDFIFNA_RS02815 513556..513762 + 207 WP_000693987.1 hypothetical protein -
LJDFIFNA_RS02820 513765..514166 + 402 WP_000695759.1 hypothetical protein -
LJDFIFNA_RS02825 514163..514510 + 348 WP_000979209.1 hypothetical protein -
LJDFIFNA_RS02830 514507..514815 + 309 WP_000144708.1 hypothetical protein -
LJDFIFNA_RS02835 514808..515044 + 237 WP_001065079.1 DUF1024 family protein Toxin
LJDFIFNA_RS02840 515049..515231 + 183 WP_000028421.1 hypothetical protein Antitoxin
LJDFIFNA_RS02845 515224..515754 + 531 WP_000185651.1 dUTP pyrophosphatase -
LJDFIFNA_RS02850 515791..515997 + 207 WP_000195785.1 DUF1381 domain-containing protein -
LJDFIFNA_RS02855 515994..516188 + 195 WP_000132920.1 hypothetical protein -
LJDFIFNA_RS02860 516185..516388 + 204 WP_001072797.1 hypothetical protein -
LJDFIFNA_RS02865 516381..516533 + 153 WP_031767608.1 transcriptional activator RinB -
LJDFIFNA_RS02870 516601..516801 + 201 WP_000265258.1 DUF1514 family protein -
LJDFIFNA_RS02875 516853..519300 + 2448 WP_031765980.1 virulence-associated E family protein -
LJDFIFNA_RS02880 519403..519507 - 105 WP_015978074.1 hypothetical protein -
LJDFIFNA_RS02885 519641..519931 + 291 WP_000665204.1 VRR-NUC domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-78)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 79 a.a.        Molecular weight: 8725.64 Da        Isoelectric Point: 3.9302

>T289392 WP_001065079.1 NZ_LR822060:514808-515044 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEE

Download         Length: 237 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6683.59 Da        Isoelectric Point: 4.3791

>AT289392 WP_000028421.1 NZ_LR822060:515049-515231 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References