Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 18786..19093 | Replicon | chromosome |
Accession | NZ_LR822060 | ||
Organism | Staphylococcus aureus isolate P3.1 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | LJDFIFNA_RS00100 | Protein ID | WP_011447039.1 |
Coordinates | 18786..18962 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 18954..19093 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LJDFIFNA_RS00080 | 14021..17806 | + | 3786 | WP_000582179.1 | hypothetical protein | - |
LJDFIFNA_RS00085 | 17796..17948 | + | 153 | WP_001153681.1 | hypothetical protein | - |
LJDFIFNA_RS00090 | 17995..18282 | + | 288 | WP_001040261.1 | hypothetical protein | - |
LJDFIFNA_RS00095 | 18340..18636 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
LJDFIFNA_RS00100 | 18786..18962 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 18954..19093 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 18954..19093 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 18954..19093 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 18954..19093 | - | 140 | NuclAT_0 | - | Antitoxin |
LJDFIFNA_RS00105 | 19015..19122 | - | 108 | WP_001791821.1 | hypothetical protein | - |
LJDFIFNA_RS00110 | 19174..19428 | + | 255 | WP_000611512.1 | phage holin | - |
LJDFIFNA_RS00115 | 19440..20195 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
LJDFIFNA_RS00120 | 20386..20877 | + | 492 | WP_031879503.1 | staphylokinase | - |
LJDFIFNA_RS00125 | 21527..21862 | + | 336 | Protein_24 | SH3 domain-containing protein | - |
LJDFIFNA_RS00130 | 21957..22406 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
LJDFIFNA_RS00135 | 22533..23705 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / chp / scn | 1..24772 | 24771 | |
- | flank | IS/Tn | - | - | 22533..23705 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T289387 WP_011447039.1 NZ_LR822060:18786-18962 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT289387 NZ_LR822060:c19093-18954 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|