Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-couple_hipB |
| Location | 674043..674691 | Replicon | chromosome |
| Accession | NZ_LR822035 | ||
| Organism | Streptococcus thermophilus isolate STH_CIRM_1051 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | H1X38_RS03570 | Protein ID | WP_014727406.1 |
| Coordinates | 674043..674408 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | J7TXL7 |
| Locus tag | H1X38_RS03575 | Protein ID | WP_002890617.1 |
| Coordinates | 674398..674691 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1X38_RS03555 | 670550..671695 | + | 1146 | WP_014727403.1 | abortive infection protein | - |
| H1X38_RS03560 | 671857..672576 | + | 720 | WP_014727404.1 | hypothetical protein | - |
| H1X38_RS03565 | 672628..673878 | + | 1251 | WP_014727405.1 | restriction endonuclease subunit S | - |
| H1X38_RS03570 | 674043..674408 | + | 366 | WP_014727406.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| H1X38_RS03575 | 674398..674691 | + | 294 | WP_002890617.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| H1X38_RS03580 | 674713..676314 | + | 1602 | WP_041829288.1 | type I restriction-modification system subunit M | - |
| H1X38_RS03585 | 676392..676811 | + | 420 | Protein_648 | PD-(D/E)XK nuclease family transposase | - |
| H1X38_RS03590 | 676912..677862 | + | 951 | Protein_649 | DNA/RNA non-specific endonuclease | - |
| H1X38_RS03595 | 678062..678622 | + | 561 | WP_014621411.1 | LemA family protein | - |
| H1X38_RS03600 | 678624..679523 | + | 900 | WP_014621412.1 | zinc metalloprotease HtpX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14511.65 Da Isoelectric Point: 9.3397
>T289384 WP_014727406.1 NZ_LR822035:674043-674408 [Streptococcus thermophilus]
VHAIYFYKDKQGNQPVLDYMRELARHDSKDSRIKLNKLNDYIELLSQHGTCAGQPYIKHLDAEIWELRPLRDRILFVAWL
DGSFVLLHHFVKKTQKTPRREIEKAKRELQDLKERGLRDEE
VHAIYFYKDKQGNQPVLDYMRELARHDSKDSRIKLNKLNDYIELLSQHGTCAGQPYIKHLDAEIWELRPLRDRILFVAWL
DGSFVLLHHFVKKTQKTPRREIEKAKRELQDLKERGLRDEE
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|