Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 499294..499940 | Replicon | chromosome |
| Accession | NZ_LR792628 | ||
| Organism | Klebsiella pneumoniae isolate SB5881 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W9BBY1 |
| Locus tag | HU711_RS02325 | Protein ID | WP_016529833.1 |
| Coordinates | 499294..499641 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W9BB18 |
| Locus tag | HU711_RS02330 | Protein ID | WP_016529832.1 |
| Coordinates | 499641..499940 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HU711_RS02315 | 495220..496653 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| HU711_RS02320 | 496671..499118 | + | 2448 | WP_174893331.1 | glycogen phosphorylase | - |
| HU711_RS02325 | 499294..499641 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HU711_RS02330 | 499641..499940 | + | 300 | WP_016529832.1 | helix-turn-helix domain-containing protein | Antitoxin |
| HU711_RS02335 | 500003..501511 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| HU711_RS02340 | 501716..502045 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| HU711_RS02345 | 502096..502926 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| HU711_RS02350 | 502976..503734 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T289350 WP_016529833.1 NZ_LR792628:499294-499641 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|