Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 473105..473691 Replicon chromosome
Accession NZ_LR792628
Organism Klebsiella pneumoniae isolate SB5881

Toxin (Protein)


Gene name doc Uniprot ID W9BMV7
Locus tag HU711_RS02215 Protein ID WP_004185990.1
Coordinates 473323..473691 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag HU711_RS02210 Protein ID WP_004174006.1
Coordinates 473105..473326 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HU711_RS02190 469262..470188 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
HU711_RS02195 470185..471462 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
HU711_RS02200 471459..472226 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
HU711_RS02205 472228..472941 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
HU711_RS02210 473105..473326 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HU711_RS02215 473323..473691 + 369 WP_004185990.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
HU711_RS02220 473964..475280 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
HU711_RS02225 475387..476274 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
HU711_RS02230 476271..477116 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
HU711_RS02235 477118..478188 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 470185..478925 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13469.85 Da        Isoelectric Point: 8.0667

>T289349 WP_004185990.1 NZ_LR792628:473323-473691 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVCRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT289349 WP_004174006.1 NZ_LR792628:473105-473326 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W9BMV7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References