Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | tisB-istR/TisB(toxin) |
Location | 32310..32685 | Replicon | chromosome |
Accession | NZ_LR792628 | ||
Organism | Klebsiella pneumoniae isolate SB5881 |
Toxin (Protein)
Gene name | tisB | Uniprot ID | A0A0H3GV52 |
Locus tag | HU711_RS00160 | Protein ID | WP_004145059.1 |
Coordinates | 32310..32429 (-) | Length | 40 a.a. |
Antitoxin (RNA)
Gene name | istR | ||
Locus tag | - | ||
Coordinates | 32606..32685 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HU711_RS00135 | 28324..28428 | + | 105 | WP_040146642.1 | hypothetical protein | - |
HU711_RS00140 | 28428..29351 | + | 924 | WP_004150274.1 | DNA-binding transcriptional regulator DsdC | - |
HU711_RS00145 | 29511..30695 | - | 1185 | WP_004181587.1 | multidrug efflux MFS transporter EmrD | - |
HU711_RS00150 | 30871..31704 | - | 834 | WP_002923296.1 | DMT family transporter | - |
HU711_RS00155 | 31773..32219 | - | 447 | WP_002923294.1 | GNAT family N-acetyltransferase | - |
HU711_RS00160 | 32310..32429 | - | 120 | WP_004145059.1 | type I toxin-antitoxin system toxin TisB | Toxin |
- | 32606..32685 | + | 80 | - | - | Antitoxin |
HU711_RS00165 | 32633..32800 | - | 168 | WP_014343455.1 | hypothetical protein | - |
HU711_RS00170 | 32813..32908 | + | 96 | WP_002923286.1 | ilvB operon leader peptide IvbL | - |
HU711_RS00175 | 33013..34701 | + | 1689 | WP_004173858.1 | acetolactate synthase large subunit | - |
HU711_RS00180 | 34705..34992 | + | 288 | WP_002923283.1 | acetolactate synthase small subunit | - |
HU711_RS00185 | 35143..35736 | + | 594 | WP_002923282.1 | transcriptional regulator UhpA | - |
HU711_RS00190 | 35754..37235 | + | 1482 | WP_004151519.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 40 a.a. Molecular weight: 4292.34 Da Isoelectric Point: 7.9965
>T289346 WP_004145059.1 NZ_LR792628:c32429-32310 [Klebsiella pneumoniae]
MCSLTTGDARMGGMDIIILILKLMVAVLQLLDAVLKQFR
MCSLTTGDARMGGMDIIILILKLMVAVLQLLDAVLKQFR
Download Length: 120 bp
Antitoxin
Download Length: 80 bp
>AT289346 NZ_LR792628:32606-32685 [Klebsiella pneumoniae]
TGTTGACGTAACACAGTGTGCTTGCGGCTACCACCTGTAACCATGCTGATAAAAACCTCGCTCCGGCGGGGTTTTTTGTT
TGTTGACGTAACACAGTGTGCTTGCGGCTACCACCTGTAACCATGCTGATAAAAACCTCGCTCCGGCGGGGTTTTTTGTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|