Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 4138698..4139304 | Replicon | chromosome |
| Accession | NZ_LR778301 | ||
| Organism | Denitratisoma oestradiolicum strain DSM 16959 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | DENOEST_RS18895 | Protein ID | WP_145770282.1 |
| Coordinates | 4138698..4139021 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DENOEST_RS18900 | Protein ID | WP_145770281.1 |
| Coordinates | 4139014..4139304 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DENOEST_RS18865 | 4133728..4134342 | + | 615 | WP_197970664.1 | PD-(D/E)XK nuclease family protein | - |
| DENOEST_RS18870 | 4134342..4134821 | + | 480 | WP_145770287.1 | hypothetical protein | - |
| DENOEST_RS20000 | 4134814..4135677 | + | 864 | WP_197970665.1 | hypothetical protein | - |
| DENOEST_RS18875 | 4135595..4137139 | + | 1545 | WP_197970666.1 | hypothetical protein | - |
| DENOEST_RS18880 | 4137277..4137750 | + | 474 | WP_145770285.1 | hypothetical protein | - |
| DENOEST_RS18885 | 4137747..4138109 | + | 363 | WP_183148178.1 | hypothetical protein | - |
| DENOEST_RS18890 | 4138106..4138690 | + | 585 | WP_145770283.1 | hypothetical protein | - |
| DENOEST_RS18895 | 4138698..4139021 | + | 324 | WP_145770282.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DENOEST_RS18900 | 4139014..4139304 | + | 291 | WP_145770281.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DENOEST_RS18905 | 4139464..4139667 | + | 204 | WP_145770280.1 | hypothetical protein | - |
| DENOEST_RS18910 | 4139654..4139878 | + | 225 | WP_183148293.1 | hypothetical protein | - |
| DENOEST_RS18915 | 4139841..4140230 | + | 390 | WP_183148294.1 | hypothetical protein | - |
| DENOEST_RS18920 | 4140427..4140987 | + | 561 | WP_145770278.1 | hypothetical protein | - |
| DENOEST_RS20005 | 4141001..4141720 | + | 720 | WP_197970667.1 | ParB N-terminal domain-containing protein | - |
| DENOEST_RS20010 | 4141693..4142406 | + | 714 | WP_197970668.1 | site-specific DNA-methyltransferase | - |
| DENOEST_RS18930 | 4142387..4143730 | + | 1344 | WP_145770276.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4132165..4167650 | 35485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12035.95 Da Isoelectric Point: 7.8165
>T289327 WP_145770282.1 NZ_LR778301:4138698-4139021 [Denitratisoma oestradiolicum]
MVFVELPIFVRCAAELFSDEDMAELQNTLLENPAAGDLIPGGRGLRKLRVPLPGRGKRGGARVIYYHWVSKAQCYLIYAY
AKNVSANLTPDQLRRLAEVMQAEIRDE
MVFVELPIFVRCAAELFSDEDMAELQNTLLENPAAGDLIPGGRGLRKLRVPLPGRGKRGGARVIYYHWVSKAQCYLIYAY
AKNVSANLTPDQLRRLAEVMQAEIRDE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|