Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 24948..25554 | Replicon | chromosome |
Accession | NZ_LR778301 | ||
Organism | Denitratisoma oestradiolicum strain DSM 16959 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | DENOEST_RS00175 | Protein ID | WP_145770282.1 |
Coordinates | 24948..25271 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DENOEST_RS00180 | Protein ID | WP_145770281.1 |
Coordinates | 25264..25554 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DENOEST_RS00150 | 20620..21060 | + | 441 | WP_183148177.1 | hypothetical protein | - |
DENOEST_RS19850 | 21064..22197 | + | 1134 | WP_197970458.1 | hypothetical protein | - |
DENOEST_RS19855 | 22184..23389 | + | 1206 | WP_197970459.1 | hypothetical protein | - |
DENOEST_RS00160 | 23527..24000 | + | 474 | WP_145770285.1 | hypothetical protein | - |
DENOEST_RS00165 | 23997..24359 | + | 363 | WP_183148178.1 | hypothetical protein | - |
DENOEST_RS00170 | 24356..24940 | + | 585 | WP_145770283.1 | hypothetical protein | - |
DENOEST_RS00175 | 24948..25271 | + | 324 | WP_145770282.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DENOEST_RS00180 | 25264..25554 | + | 291 | WP_145770281.1 | helix-turn-helix domain-containing protein | Antitoxin |
DENOEST_RS00185 | 25714..25917 | + | 204 | WP_145770280.1 | hypothetical protein | - |
DENOEST_RS00190 | 25904..26482 | + | 579 | WP_145770279.1 | hypothetical protein | - |
DENOEST_RS00195 | 26678..27238 | + | 561 | WP_145770278.1 | hypothetical protein | - |
DENOEST_RS00200 | 27253..28659 | + | 1407 | WP_197970675.1 | site-specific DNA-methyltransferase | - |
DENOEST_RS00205 | 28640..29773 | + | 1134 | WP_197970460.1 | ParB N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 18441..67575 | 49134 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12035.95 Da Isoelectric Point: 7.8165
>T289323 WP_145770282.1 NZ_LR778301:24948-25271 [Denitratisoma oestradiolicum]
MVFVELPIFVRCAAELFSDEDMAELQNTLLENPAAGDLIPGGRGLRKLRVPLPGRGKRGGARVIYYHWVSKAQCYLIYAY
AKNVSANLTPDQLRRLAEVMQAEIRDE
MVFVELPIFVRCAAELFSDEDMAELQNTLLENPAAGDLIPGGRGLRKLRVPLPGRGKRGGARVIYYHWVSKAQCYLIYAY
AKNVSANLTPDQLRRLAEVMQAEIRDE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|